Ec-00_005500.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_005500.1 vs. uniprot
Match: D7G196_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G196_ECTSI) HSP 1 Score: 91.3 bits (225), Expect = 1.370e-23 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS 42 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS Sbjct: 1 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS 42
BLAST of Ec-00_005500.1 vs. uniprot
Match: D7FIY3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIY3_ECTSI) HSP 1 Score: 74.3 bits (181), Expect = 1.030e-16 Identity = 36/42 (85.71%), Postives = 37/42 (88.10%), Query Frame = 0 Query: 1 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS 42 MGLSRGA+LSRAEKGEHGLARGGRVRPPA MPFM GC RS Sbjct: 1 MGLSRGANLSRAEKGEHGLARGGRVRPPAIVMPFMGGGCFRS 42 The following BLAST results are available for this feature:
BLAST of Ec-00_005500.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-00_005500.1 ID=Ec-00_005500.1|Name=Ec-00_005500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=43bpback to top |