Ec-28_000030.2 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-28_000030.2 vs. uniprot
Match: D7FIE9_ECTSI (Peptide-methionine (R)-S-oxide reductase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIE9_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 1.280e-11 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 0 Query: 91 MTSENNSSSSTKRVVAGAVSASGYDVTRRKKGTAQLAR 128 MTSENNSSSSTKRVVAGAVSASGYDVTRRKKGTAQLAR Sbjct: 1 MTSENNSSSSTKRVVAGAVSASGYDVTRRKKGTAQLAR 38
BLAST of Ec-28_000030.2 vs. uniprot
Match: A0A6H5JXE9_9PHAE (Peptide-methionine (R)-S-oxide reductase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXE9_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 9.620e-6 Identity = 32/38 (84.21%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 91 MTSENNSSSSTKRVVAGAVSASGYDVTRRKKGTAQLAR 128 M SEN SSSST+ VVAG VSASGYDVTRRKK TAQLAR Sbjct: 1 MASEN-SSSSTEHVVAGTVSASGYDVTRRKKSTAQLAR 37 The following BLAST results are available for this feature:
BLAST of Ec-28_000030.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-28_000030.2 ID=Ec-28_000030.2|Name=Ec-28_000030.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=137bpback to top |