Ec-27_005700.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-27_005700.1 vs. uniprot
Match: D8LB09_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LB09_ECTSI) HSP 1 Score: 121 bits (304), Expect = 1.880e-33 Identity = 56/59 (94.92%), Postives = 58/59 (98.31%), Query Frame = 0 Query: 32 PWHLQLEHHLGTPGYNHASHAINSSGREVDGDEQPQLLELEAGGLQLGRRVRHLQGGRT 90 PWHLQLEHHLGTPGYNHASHAINSSGREVDGDEQPQLLELEAGGLQLGRRVRHLQG ++ Sbjct: 4 PWHLQLEHHLGTPGYNHASHAINSSGREVDGDEQPQLLELEAGGLQLGRRVRHLQGSQS 62
BLAST of Ec-27_005700.1 vs. uniprot
Match: A0A6H5JBN0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBN0_9PHAE) HSP 1 Score: 87.4 bits (215), Expect = 1.220e-19 Identity = 46/59 (77.97%), Postives = 48/59 (81.36%), Query Frame = 0 Query: 87 GGRTTISPSNRQSMYLRSLQGEGGGGMGMASEVLPASDEVAVPKQSWRLSPGPGPRRVL 145 GGR I SNRQS+YLRSLQ EGG +GMASEVLPASDE AVPKQSW LSPG GPR VL Sbjct: 37 GGRRIIFSSNRQSIYLRSLQREGGR-VGMASEVLPASDEAAVPKQSWHLSPGSGPRHVL 94 The following BLAST results are available for this feature:
BLAST of Ec-27_005700.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-27_005700.1 ID=Ec-27_005700.1|Name=Ec-27_005700.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=155bpback to top |