Ec-00_006460.2 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_006460.2 vs. uniprot
Match: A0A6H5JU18_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JU18_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 1.200e-18 Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = 0 Query: 1 MIFDLRRSITWFWPTPGPRRSSSRLDFNPPTSAQRRGQNWLCAQE 45 M FDLRRS TWFWPTPGPR+SSSR+DFNPPTSAQ R QNWLCAQE Sbjct: 1 MTFDLRRSTTWFWPTPGPRKSSSRVDFNPPTSAQGRRQNWLCAQE 45
BLAST of Ec-00_006460.2 vs. uniprot
Match: D7FHW2_ECTSI (Protein kinase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHW2_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 4.200e-18 Identity = 50/96 (52.08%), Postives = 60/96 (62.50%), Query Frame = 0 Query: 1 MIFDLRRSITWFWPTPGPRRSSSRLDFNPPTSAQRRGQNWLCAQEHASG----------------RRCSVRKPFRFRWLNINRGKALTPMASWKSM 80 MIFDLRRSITWFWPTPGPRRSSSRLDFNPPTSAQRRGQ A+E G RR S+R+P R L++ +P+ S +++ Sbjct: 1 MIFDLRRSITWFWPTPGPRRSSSRLDFNPPTSAQRRGQ-LAAAEERGVGTTMLLGSMDSCLPPKSRRTSLRRPLR--QLSLGEPLPASPLISTRNL 93 The following BLAST results are available for this feature:
BLAST of Ec-00_006460.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-00_006460.2 ID=Ec-00_006460.2|Name=Ec-00_006460.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=132bpback to top |