Ec-27_005390.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-27_005390.1 vs. uniprot
Match: D8LB34_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LB34_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 2.330e-6 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 1 Query: 1 MSLPSYADWLYLDEDLLDITDEPLQ 75 MSLPSYADWLYLDEDLLDITDE ++ Sbjct: 1 MSLPSYADWLYLDEDLLDITDEEIE 25 The following BLAST results are available for this feature:
BLAST of Ec-27_005390.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-27_005390.1 ID=Ec-27_005390.1|Name=Ec-27_005390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=38bpback to top spliced messenger RNA >Ec-27_005390.1 ID=Ec-27_005390.1|Name=Ec-27_005390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=114bp|location=Sequence derived from alignment at chr_27:4869495..4869868- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGTCTCTGCCTTCCTACGCGGACTGGTTATACCTCGACGAGGATCTTTTback to top protein sequence of Ec-27_005390.1 >Ec-27_005390.1 ID=Ec-27_005390.1|Name=Ec-27_005390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=38bp MSLPSYADWLYLDEDLLDITDEPLQWKNGSFRHKVVR*back to top mRNA from alignment at chr_27:4869495..4869868- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-27_005390.1 ID=Ec-27_005390.1|Name=Ec-27_005390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=374bp|location=Sequence derived from alignment at chr_27:4869495..4869868- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_27:4869495..4869868- >Ec-27_005390.1 ID=Ec-27_005390.1|Name=Ec-27_005390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=114bp|location=Sequence derived from alignment at chr_27:4869495..4869868- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-27_005390.1' has the following synonyms
|