Ec-00_005880.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_005880.1 vs. uniprot
Match: D7G2E6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2E6_ECTSI) HSP 1 Score: 102 bits (255), Expect = 5.660e-28 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1 Query: 1 MMWANIWKLLGATMLPMFTAGTGLGMTSTTEDGGVIAVRDGVVVQMSSW 147 MMWANIWKLLGATMLPMFTAGTGLGMTSTTEDGGVIAVRDGVVVQMSSW Sbjct: 1 MMWANIWKLLGATMLPMFTAGTGLGMTSTTEDGGVIAVRDGVVVQMSSW 49
BLAST of Ec-00_005880.1 vs. uniprot
Match: D7FSJ7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSJ7_ECTSI) HSP 1 Score: 73.2 bits (178), Expect = 5.670e-14 Identity = 33/44 (75.00%), Postives = 37/44 (84.09%), Query Frame = 1 Query: 4 MWANIWKLLGATMLPMFTAGTGLGMTSTTEDGGVIAVRDGVVVQ 135 MWANIW++LG TM+P+FT GTGL M S ED GVIAVRDGVVVQ Sbjct: 20 MWANIWQILGVTMIPIFTVGTGLSMASRAEDAGVIAVRDGVVVQ 63
BLAST of Ec-00_005880.1 vs. uniprot
Match: A0A6H5L7B0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L7B0_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 1.940e-8 Identity = 28/44 (63.64%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 4 MWANIWKLLGATMLPMFTAGTGLGMTSTTEDGGVIAVRDGVVVQ 135 MWA++ +++GATM+ M TAGTGL M S T +GGVI VR GVVVQ Sbjct: 1 MWASVRRMVGATMVSMLTAGTGLHMESVTANGGVIDVRHGVVVQ 44 The following BLAST results are available for this feature:
BLAST of Ec-00_005880.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_005880.1 ID=Ec-00_005880.1|Name=Ec-00_005880.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=50bpback to top spliced messenger RNA >Ec-00_005880.1 ID=Ec-00_005880.1|Name=Ec-00_005880.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=150bp|location=Sequence derived from alignment at chr_00:9377728..9378491- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGATGTGGGCAAACATATGGAAACTGTTGGGAGCCACCATGCTTCCAATback to top protein sequence of Ec-00_005880.1 >Ec-00_005880.1 ID=Ec-00_005880.1|Name=Ec-00_005880.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=50bp MMWANIWKLLGATMLPMFTAGTGLGMTSTTEDGGVIAVRDGVVVQMSSW*back to top mRNA from alignment at chr_00:9377728..9378491- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_005880.1 ID=Ec-00_005880.1|Name=Ec-00_005880.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=764bp|location=Sequence derived from alignment at chr_00:9377728..9378491- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:9377728..9378491- >Ec-00_005880.1 ID=Ec-00_005880.1|Name=Ec-00_005880.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=150bp|location=Sequence derived from alignment at chr_00:9377728..9378491- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_005880.1' has the following synonyms
|