Homology
The following BLAST results are available for this feature:
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Property Name | Value |
Stop | 1 |
Start | 1 |
Model size | 174 |
Hectar predicted targeting category | signal anchor |
Exons | 1 |
Ec32 ortholog description | Hypothetical protein |
Ec32 ortholog | Ec-26_000210.1 |
Cds size | 174 |
Relationships
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type | Position |
1682348746.8028834-CDS-Ecto-sp6_S_contig104:314413..314587 | 1682348746.8028834-CDS-Ecto-sp6_S_contig104:314413..314587 | Ectocarpus species6 EcLAC_371 | CDS | Ecto-sp6_S_contig104 314414..314587 + |
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig104.952.1 >prot_Ecto-sp6_S_contig104.952.1 ID=prot_Ecto-sp6_S_contig104.952.1|Name=mRNA_Ecto-sp6_S_contig104.952.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=58bp
MSLLDSLELFMNVSFVRELIWRAGYSRHVRLTLVASYLGICPVVFILIIF PCPRQLD* back to topmRNA from alignment at Ecto-sp6_S_contig104:314414..314587+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below. >mRNA_Ecto-sp6_S_contig104.952.1 ID=mRNA_Ecto-sp6_S_contig104.952.1|Name=mRNA_Ecto-sp6_S_contig104.952.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=174bp|location=Sequence derived from alignment at Ecto-sp6_S_contig104:314414..314587+ (Ectocarpus species6 EcLAC_371) ATGTCCTTGTTGGACTCTCTGGAACTTTTCATGAATGTATCTTTTGTTCG
CGAGCTCATTTGGCGAGCTGGCTATTCTAGACATGTACGTTTAACGTTAG
TCGCATCATATTTGGGGATCTGTCCTGTCGTGTTTATTTTAATTATTTTT
CCATGCCCCCGGCAGCTGGACTAG back to topCoding sequence (CDS) from alignment at Ecto-sp6_S_contig104:314414..314587+ >mRNA_Ecto-sp6_S_contig104.952.1 ID=mRNA_Ecto-sp6_S_contig104.952.1|Name=mRNA_Ecto-sp6_S_contig104.952.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=174bp|location=Sequence derived from alignment at Ecto-sp6_S_contig104:314414..314587+ (Ectocarpus species6 EcLAC_371) ATGTCCTTGTTGGACTCTCTGGAACTTTTCATGAATGTATCTTTTGTTCG CGAGCTCATTTGGCGAGCTGGCTATTCTAGACATGTACGTTTAACGTTAG TCGCATCATATTTGGGGATCTGTCCTGTCGTGTTTATTTTAATTATTTTT CCATGCCCCCGGCAGCTGGACTAG back to top
|