mRNA_Ecto-sp6_S_contig102.862.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig102.862.1 vs. uniprot
Match: D8LGJ8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LGJ8_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 1.680e-18 Identity = 38/41 (92.68%), Postives = 39/41 (95.12%), Query Frame = -1 Query: 61 GAAWAFVVVVGALTRVVSSSWVFLAGGWEEPESAWQWRKDP 183 GAAWAFVVVVGALTRVVSSS FLAGGWEEPESAWQWR+DP Sbjct: 22 GAAWAFVVVVGALTRVVSSSRFFLAGGWEEPESAWQWREDP 62
BLAST of mRNA_Ecto-sp6_S_contig102.862.1 vs. uniprot
Match: D8LR06_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LR06_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 3.750e-16 Identity = 42/59 (71.19%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 63 GSCTAVITDLRQRASRCRGQRGHLSL*SARL-PGW*AAAGFFLPVVGRSRSPLGNGEKT 236 GSCTAVITDLRQRASRCRG + S R G GFFLPVVGRSRSPLGNGEKT Sbjct: 19 GSCTAVITDLRQRASRCRGGSVGICRCSRRAYQGGEQPQGFFLPVVGRSRSPLGNGEKT 77
BLAST of mRNA_Ecto-sp6_S_contig102.862.1 vs. uniprot
Match: A0A6H5KB56_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KB56_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 2.740e-8 Identity = 32/57 (56.14%), Postives = 36/57 (63.16%), Query Frame = -3 Query: 119 DEGGAAQGFSVGRFSR*RGAAQQSSQISANALPDVGGSVGICRCSRRAYQGGEQQLG 289 DEGGAAQGF +G G+ + + A GGSV ICRCSRRAYQGGEQQ G Sbjct: 3 DEGGAAQGFLLGGSQDEGGSCSVITDLRQRASRCRGGSVRICRCSRRAYQGGEQQQG 59 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig102.862.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig102.862.1 >prot_Ecto-sp6_S_contig102.862.1 ID=prot_Ecto-sp6_S_contig102.862.1|Name=mRNA_Ecto-sp6_S_contig102.862.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=102bp KLKLLPVFSATGTNRIVGLGRVFSPLPSGLRLLPTTGKKNPAAAHHPGKRback to top mRNA from alignment at Ecto-sp6_S_contig102:454550..454900+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig102.862.1 ID=mRNA_Ecto-sp6_S_contig102.862.1|Name=mRNA_Ecto-sp6_S_contig102.862.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=351bp|location=Sequence derived from alignment at Ecto-sp6_S_contig102:454550..454900+ (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig102:454550..454900+ >mRNA_Ecto-sp6_S_contig102.862.1 ID=mRNA_Ecto-sp6_S_contig102.862.1|Name=mRNA_Ecto-sp6_S_contig102.862.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=306bp|location=Sequence derived from alignment at Ecto-sp6_S_contig102:454550..454900+ (Ectocarpus species6 EcLAC_371)back to top |