mRNA_Ecto-sp6_S_contig102.852.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig102.852.1 vs. uniprot
Match: D7G977_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G977_ECTSI) HSP 1 Score: 105 bits (262), Expect = 1.330e-24 Identity = 49/52 (94.23%), Postives = 51/52 (98.08%), Query Frame = -2 Query: 39 ATAEASHDPSDPASVYVDLLVNGDPAPFVFRIPPKKAPHRQPRLSDGGVSEL 194 ATAEASHDP+DPASV+VDLLVNGDPAP VFRIPPKKAPHRQPRLSDGGVSEL Sbjct: 170 ATAEASHDPADPASVFVDLLVNGDPAPLVFRIPPKKAPHRQPRLSDGGVSEL 221
BLAST of mRNA_Ecto-sp6_S_contig102.852.1 vs. uniprot
Match: A0A6H5JC06_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC06_9PHAE) HSP 1 Score: 104 bits (260), Expect = 2.470e-24 Identity = 49/51 (96.08%), Postives = 50/51 (98.04%), Query Frame = -2 Query: 42 ATAEASHDPSDPASVYVDLLVNGDPAPFVFRIPPKKAPHRQPRLSDGGVSE 194 ATAEASHDPSDPASV+VDLLVNGDPAP VFRIPPKKAPHRQPRLSDGGVSE Sbjct: 126 ATAEASHDPSDPASVFVDLLVNGDPAPLVFRIPPKKAPHRQPRLSDGGVSE 176 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig102.852.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig102.852.1 >prot_Ecto-sp6_S_contig102.852.1 ID=prot_Ecto-sp6_S_contig102.852.1|Name=mRNA_Ecto-sp6_S_contig102.852.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=85bp MLHNYKTENARQLSSETPPSDNRGCRWGAFLGGMRNTNGAGSPLTRRSTYback to top mRNA from alignment at Ecto-sp6_S_contig102:277659..278477+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig102.852.1 ID=mRNA_Ecto-sp6_S_contig102.852.1|Name=mRNA_Ecto-sp6_S_contig102.852.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=819bp|location=Sequence derived from alignment at Ecto-sp6_S_contig102:277659..278477+ (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig102:277659..278477+ >mRNA_Ecto-sp6_S_contig102.852.1 ID=mRNA_Ecto-sp6_S_contig102.852.1|Name=mRNA_Ecto-sp6_S_contig102.852.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=255bp|location=Sequence derived from alignment at Ecto-sp6_S_contig102:277659..278477+ (Ectocarpus species6 EcLAC_371)back to top |