mRNA_Ecto-sp6_S_contig10.493.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig10.493.1 vs. uniprot
Match: A0A6H5K8T1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8T1_9PHAE) HSP 1 Score: 90.5 bits (223), Expect = 2.570e-19 Identity = 50/83 (60.24%), Postives = 57/83 (68.67%), Query Frame = 2 Query: 5 WEGWAECS*PNPCHLYLASSSKARVGDLLLPA--PDVRSGGCDCLLESNGVRALVVEKLGFVIDTGKDPFEGLPEELDDPPDE 247 W GW +C HLY+ASS +ARVGD LLPA PD R CDCLLE GV L VE+LG VIDTGKDPFEGL +E + P+E Sbjct: 622 WTGWLDCEKHPSQHLYMASSVEARVGDPLLPAAAPDARR--CDCLLEPGGVLRLAVEELGPVIDTGKDPFEGLSDEDTEDPEE 702 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig10.493.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig10.493.1 >prot_Ecto-sp6_S_contig10.493.1 ID=prot_Ecto-sp6_S_contig10.493.1|Name=mRNA_Ecto-sp6_S_contig10.493.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=82bp MVGGLGRVFVAQPVPPLPGILIQGKGRRLASSRSRCAKWRLRLPAGIEWGback to top mRNA from alignment at Ecto-sp6_S_contig10:757299..757966- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig10.493.1 ID=mRNA_Ecto-sp6_S_contig10.493.1|Name=mRNA_Ecto-sp6_S_contig10.493.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=668bp|location=Sequence derived from alignment at Ecto-sp6_S_contig10:757299..757966- (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig10:757299..757966- >mRNA_Ecto-sp6_S_contig10.493.1 ID=mRNA_Ecto-sp6_S_contig10.493.1|Name=mRNA_Ecto-sp6_S_contig10.493.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=246bp|location=Sequence derived from alignment at Ecto-sp6_S_contig10:757299..757966- (Ectocarpus species6 EcLAC_371)back to top |