prot_Ecto-sp13_S_contig98832.21524.1 (polypeptide) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: D8LNC1_ECTSI (RIBOSOMAL_L9 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LNC1_ECTSI) HSP 1 Score: 81.6 bits (200), Expect = 8.350e-18 Identity = 37/40 (92.50%), Postives = 39/40 (97.50%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 +KVILTDDV GTGYRGEYV+IRGGFMRNFLFPSKRAIYAT Sbjct: 37 VKVILTDDVSGTGYRGEYVDIRGGFMRNFLFPSKRAIYAT 76
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A2V6R5P8_9BACT (50S ribosomal protein L9 n=2 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6R5P8_9BACT) HSP 1 Score: 53.1 bits (126), Expect = 1.470e-7 Identity = 24/40 (60.00%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 +KVIL DDVG G+RGE E+ G+ RNFL P KRA+ AT Sbjct: 1 MKVILLDDVGTLGHRGEVREVSDGYARNFLIPQKRALTAT 40
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: C7GYV7_9FIRM (50S ribosomal protein L9 n=1 Tax=Eubacterium saphenum ATCC 49989 TaxID=592031 RepID=C7GYV7_9FIRM) HSP 1 Score: 52.0 bits (123), Expect = 6.430e-7 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 +KVIL +DV GTGY G+ VE++ GF R+ L PSK AI AT Sbjct: 1 MKVILKEDVRGTGYEGDVVEVKDGFARHKLIPSKLAIKAT 40
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A1V5CWW1_9DELT (50S ribosomal protein L9 n=1 Tax=Syntrophorhabdus sp. PtaU1.Bin058 TaxID=1811704 RepID=A0A1V5CWW1_9DELT) HSP 1 Score: 51.2 bits (121), Expect = 8.360e-7 Identity = 23/40 (57.50%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 +KVILT+D+ GTG +GE V ++ G+ RNFL P RAI AT Sbjct: 1 MKVILTEDLKGTGKKGEVVNVKDGYGRNFLIPDGRAIPAT 40
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A3R6VCN3_9STRA (RIBOSOMAL_L9 domain-containing protein n=2 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A3R6VCN3_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 1.450e-6 Identity = 19/40 (47.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 ++V+L +DV G+RG+ V ++ G+ RNFL+P K+A+YAT Sbjct: 18 VEVVLKEDVPKLGFRGDVVSVKAGYARNFLYPEKKAVYAT 57
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A3M6VRU6_9STRA (RIBOSOMAL_L9 domain-containing protein n=1 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6VRU6_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.740e-6 Identity = 19/40 (47.50%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 + ++L +DVG GYRG+ V ++ G+ RN+L+P K A+YAT Sbjct: 28 VSMVLKEDVGNLGYRGDEVFVKAGYARNYLYPEKLAVYAT 67
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A485KPG0_9STRA (Aste57867_10078 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KPG0_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 2.510e-6 Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 3 VILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 ++L +DV G+RG+ V ++ GF RNFL+P K+A+YAT Sbjct: 1 MVLKEDVPKLGFRGDVVSVKAGFARNFLYPQKKAVYAT 38
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A847C9J3_9FIRM (50S ribosomal protein L9 (Fragment) n=1 Tax=Oscillospiraceae bacterium TaxID=2485925 RepID=A0A847C9J3_9FIRM) HSP 1 Score: 48.1 bits (113), Expect = 3.610e-6 Identity = 22/40 (55.00%), Postives = 27/40 (67.50%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 +KV+L D+ GTG R E VE+ G+ RNFLFP K A AT Sbjct: 1 MKVVLLQDIKGTGKRDELVEVSDGYARNFLFPRKLAKEAT 40
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A397ERT2_9STRA (RIBOSOMAL_L9 domain-containing protein n=5 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A397ERT2_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 3.960e-6 Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 3 VILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 V+L +DV G+RG+ V ++ G+ RNFL+P K+A+YAT Sbjct: 23 VVLKEDVPKLGFRGDVVAVKAGYARNFLYPEKKAVYAT 60
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Match: A0A6G0XWF7_9STRA (RIBOSOMAL_L9 domain-containing protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XWF7_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 4.070e-6 Identity = 18/40 (45.00%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 1 LKVILTDDVGGTGYRGEYVEIRGGFMRNFLFPSKRAIYAT 40 ++++L +DV G+RG+ V ++ G+ RNFL+P K+A+YAT Sbjct: 22 VEMVLKEDVPKLGFRGDVVSVKAGYARNFLYPEKKAVYAT 61 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig98832.21524.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_Ecto-sp13_S_contig98832.21524.1 ID=prot_Ecto-sp13_S_contig98832.21524.1|Name=mRNA_Ecto-sp13_S_contig98832.21524.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=40bpback to top |