mRNA_Ecto-sp13_S_contig9985.21631.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig9985.21631.1 vs. uniprot
Match: A0A6H5K0V8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0V8_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 2.100e-12 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 3 Query: 81 RCAGMEWMRNVIFGEGNERETSSPVRIITRHFT 179 RCAG++WMRNVIFGEGNE ETSSPVRIITR+FT Sbjct: 40 RCAGIDWMRNVIFGEGNEGETSSPVRIITRYFT 72
BLAST of mRNA_Ecto-sp13_S_contig9985.21631.1 vs. uniprot
Match: A0A6H5L213_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L213_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 3.410e-11 Identity = 28/29 (96.55%), Postives = 28/29 (96.55%), Query Frame = 3 Query: 93 MEWMRNVIFGEGNERETSSPVRIITRHFT 179 MEWMRNVIFGEGNE ETSSPVRIITRHFT Sbjct: 1 MEWMRNVIFGEGNEGETSSPVRIITRHFT 29
BLAST of mRNA_Ecto-sp13_S_contig9985.21631.1 vs. uniprot
Match: A0A6H5L368_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L368_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 2.230e-10 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 3 Query: 78 ERCAGMEWMRNVIFGEGNERETSSPVRIITRHFT 179 +R AGM+ MRN+IFGEGNE ETSSPVRIITRHFT Sbjct: 30 QRYAGMKLMRNIIFGEGNEGETSSPVRIITRHFT 63 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig9985.21631.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig9985.21631.1 >prot_Ecto-sp13_S_contig9985.21631.1 ID=prot_Ecto-sp13_S_contig9985.21631.1|Name=mRNA_Ecto-sp13_S_contig9985.21631.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=61bp FITPPRDDRLRVKLAYSPGVPTPSQGRGAPGWNGCETSFSARATNEKPRHback to top mRNA from alignment at Ecto-sp13_S_contig9985:4851..6008+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig9985.21631.1 ID=mRNA_Ecto-sp13_S_contig9985.21631.1|Name=mRNA_Ecto-sp13_S_contig9985.21631.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=1158bp|location=Sequence derived from alignment at Ecto-sp13_S_contig9985:4851..6008+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig9985:4851..6008+ >mRNA_Ecto-sp13_S_contig9985.21631.1 ID=mRNA_Ecto-sp13_S_contig9985.21631.1|Name=mRNA_Ecto-sp13_S_contig9985.21631.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=183bp|location=Sequence derived from alignment at Ecto-sp13_S_contig9985:4851..6008+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |