mRNA_Ecto-sp13_S_contig99307.21579.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig99307.21579.1 vs. uniprot
Match: A0A6H5L6K1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L6K1_9PHAE) HSP 1 Score: 94.0 bits (232), Expect = 8.950e-23 Identity = 52/63 (82.54%), Postives = 54/63 (85.71%), Query Frame = 1 Query: 52 IACMGSVSAPPGANQGSQESKRHQAFKTPLKSETRQLSRKKAALCPFVRSSAGGSLGGRRIML 240 +ACMGSVSAPPGA Q SQ SKRHQA KTPLKSETRQLSR KAAL PFVRSS G SLGGRR +L Sbjct: 1 MACMGSVSAPPGAIQTSQGSKRHQACKTPLKSETRQLSRNKAALRPFVRSSTGRSLGGRRAIL 63
BLAST of mRNA_Ecto-sp13_S_contig99307.21579.1 vs. uniprot
Match: A0A6H5JJ82_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ82_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 4.480e-14 Identity = 42/63 (66.67%), Postives = 49/63 (77.78%), Query Frame = 1 Query: 52 IACMGSVSAPPGANQGSQESKRHQAFKTPLKSETRQLSRKKAALCPFVRSSAGGSLGGRRIML 240 +ACMGSVS+PPGA QGSQ+S+R+QA + K E R +SRKKAAL VRSSAG LGGRR ML Sbjct: 1 MACMGSVSSPPGAIQGSQQSERYQACEASSKREIRHMSRKKAALHTLVRSSAG--LGGRRAML 61
BLAST of mRNA_Ecto-sp13_S_contig99307.21579.1 vs. uniprot
Match: A0A6H5JMJ2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMJ2_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 1.630e-12 Identity = 41/65 (63.08%), Postives = 48/65 (73.85%), Query Frame = 1 Query: 52 IACMGSVSAPPGANQGSQESKRHQAFKTPLKSETRQLSRKKAALCPFVRSSAGGSLGG--RRIML 240 +ACMGSV PP A SQ+S+ +QA K K ETR++SR+KAAL PFVRSSAG SLGG RR ML Sbjct: 1 MACMGSVPFPPSAAHSSQQSESYQACKASSKRETRRMSREKAALRPFVRSSAGRSLGGGGRRAML 65 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig99307.21579.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig99307.21579.1 >prot_Ecto-sp13_S_contig99307.21579.1 ID=prot_Ecto-sp13_S_contig99307.21579.1|Name=mRNA_Ecto-sp13_S_contig99307.21579.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=80bp ASSLLWTFVLVGVASVRIACMGSVSAPPGANQGSQESKRHQAFKTPLKSEback to top mRNA from alignment at Ecto-sp13_S_contig99307:226..467+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig99307.21579.1 ID=mRNA_Ecto-sp13_S_contig99307.21579.1|Name=mRNA_Ecto-sp13_S_contig99307.21579.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=242bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99307:226..467+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig99307:226..467+ >mRNA_Ecto-sp13_S_contig99307.21579.1 ID=mRNA_Ecto-sp13_S_contig99307.21579.1|Name=mRNA_Ecto-sp13_S_contig99307.21579.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=240bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99307:226..467+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |