mRNA_Ecto-sp13_S_contig99133.21560.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig99133.21560.1 vs. uniprot
Match: D7FKZ9_ECTSI (Ankyrin repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKZ9_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 3.400e-10 Identity = 35/61 (57.38%), Postives = 40/61 (65.57%), Query Frame = 1 Query: 1 LDLLLRWGADETALDNEGRTPAERLN---DMPAAAGPGSRRQGVASPRLAGHAPCTRFDGE 174 + LLLRWGADET LD +TPA+R N + AGPGSRRQGVA P LA HA +GE Sbjct: 326 VSLLLRWGADETILDEHHKTPADRTNHQRESAPPAGPGSRRQGVAPPGLARHASFAHPEGE 386
BLAST of mRNA_Ecto-sp13_S_contig99133.21560.1 vs. uniprot
Match: D7FSI6_ECTSI (Similar to ankyrin 2,3/unc44 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSI6_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 5.350e-6 Identity = 28/44 (63.64%), Postives = 33/44 (75.00%), Query Frame = 2 Query: 50 RAALRRKDSTT----CPLLLARAPADRAWRRRGWLVMLRARAST 169 R A+ R D+T +LLARAPADRAWRRRGW+VMLRAR+ T Sbjct: 317 RLAIHRPDATEERAGALVLLARAPADRAWRRRGWVVMLRARSET 360
BLAST of mRNA_Ecto-sp13_S_contig99133.21560.1 vs. uniprot
Match: D8LNI8_ECTSI (EsV-1-8 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNI8_ECTSI) HSP 1 Score: 48.1 bits (113), Expect = 5.310e-5 Identity = 24/28 (85.71%), Postives = 26/28 (92.86%), Query Frame = 2 Query: 89 LLLARAPADRAWRRRGWLVMLRARASTA 172 LLL+RAPADRAWRRRGWLVMLR+R S A Sbjct: 84 LLLSRAPADRAWRRRGWLVMLRSRDSKA 111
BLAST of mRNA_Ecto-sp13_S_contig99133.21560.1 vs. uniprot
Match: A0A6H5K1F4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1F4_9PHAE) HSP 1 Score: 48.1 bits (113), Expect = 6.640e-5 Identity = 28/53 (52.83%), Postives = 33/53 (62.26%), Query Frame = 2 Query: 5 TSCSGGARMKPHWTTRAALRRKDSTTCPLLLARAPADRAWRRRGWLVMLRARA 163 T C GG+ + T+ R + +LLARAPADR WRRR WLVMLRARA Sbjct: 404 TRCVGGSATRHDSLTKEIQRAR------VLLARAPADRTWRRRCWLVMLRARA 450
BLAST of mRNA_Ecto-sp13_S_contig99133.21560.1 vs. uniprot
Match: D7FKZ6_ECTSI (Similar to ankyrin 2,3/unc44 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKZ6_ECTSI) HSP 1 Score: 48.1 bits (113), Expect = 6.640e-5 Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 2 Query: 89 LLLARAPADRAWRRRGWLVMLRAR 160 LLLARAPADRAWRRRGWLVMLR+R Sbjct: 476 LLLARAPADRAWRRRGWLVMLRSR 499 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig99133.21560.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig99133.21560.1 >prot_Ecto-sp13_S_contig99133.21560.1 ID=prot_Ecto-sp13_S_contig99133.21560.1|Name=mRNA_Ecto-sp13_S_contig99133.21560.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=58bp LDLLLRWGADETALDNEGRTPAERLNDMPAAAGPGSRRQGVASPRLAGHAback to top mRNA from alignment at Ecto-sp13_S_contig99133:3..217+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig99133.21560.1 ID=mRNA_Ecto-sp13_S_contig99133.21560.1|Name=mRNA_Ecto-sp13_S_contig99133.21560.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=215bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99133:3..217+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig99133:3..217+ >mRNA_Ecto-sp13_S_contig99133.21560.1 ID=mRNA_Ecto-sp13_S_contig99133.21560.1|Name=mRNA_Ecto-sp13_S_contig99133.21560.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=174bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99133:3..217+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |