mRNA_Ecto-sp13_S_contig99.21543.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig99.21543.1 vs. uniprot
Match: D7FH80_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH80_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 6.440e-18 Identity = 43/68 (63.24%), Postives = 51/68 (75.00%), Query Frame = 3 Query: 201 SPPTPDEWG-LVAIGDATKLAELVLVWSGSIAEQAHSLLTRCISLLEKEVAFSAPASSPLQWPPTSLG 401 S PDEWG VA GDATKLAELVL+WSG E+A S++ C+S+LEKEVA S P SSPL+ PT+LG Sbjct: 8 SSARPDEWGPAVASGDATKLAELVLLWSGLKPERALSVIRDCVSVLEKEVALSTPGSSPLRATPTTLG 75
BLAST of mRNA_Ecto-sp13_S_contig99.21543.1 vs. uniprot
Match: A0A6H5KPY7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPY7_9PHAE) HSP 1 Score: 85.5 bits (210), Expect = 2.210e-16 Identity = 45/65 (69.23%), Postives = 50/65 (76.92%), Query Frame = 3 Query: 210 TPDEWGL-VAIGDATKLAELVLVWSGSIAEQAHSLLTRCISLLEKEVAFSAPASSPLQWPPTSLG 401 +PD+WGL VA GDATKLAELVLVWSGS E A SLL C+ LLE+E AFS P SSPLQ P +LG Sbjct: 66 SPDKWGLAVATGDATKLAELVLVWSGSRPEAALSLLRECVLLLEEEAAFSVPDSSPLQSPSCTLG 130
BLAST of mRNA_Ecto-sp13_S_contig99.21543.1 vs. uniprot
Match: D7FTA8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTA8_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 5.400e-15 Identity = 40/64 (62.50%), Postives = 46/64 (71.88%), Query Frame = 3 Query: 213 PDEWG-LVAIGDATKLAELVLVWSGSIAEQAHSLLTRCISLLEKEVAFSAPASSPLQWPPTSLG 401 PD WG VA GDAT LAELVL+W G + A S+L RC+++LEKEVA SAP SSPL P TS G Sbjct: 12 PDAWGSAVASGDATGLAELVLLWCGVLPHPALSILRRCVAVLEKEVALSAPTSSPLPSPQTSRG 75
BLAST of mRNA_Ecto-sp13_S_contig99.21543.1 vs. uniprot
Match: D7G2S9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2S9_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 1.520e-10 Identity = 50/129 (38.76%), Postives = 57/129 (44.19%), Query Frame = 3 Query: 15 VIHQVSWRETSVQEPQGLINGLRS*RAATR*SLPSWCFFRRVQVCASLLETKLAFSTPAFSQSPPTPDEWGLVAIGDATKLAELVLVWSGSIAEQAHSLLTRCISLLEKEVAFSAPASSPLQWPPTSLG 401 V H+ S RETSV+ PQGL+NG R RAATR LA+LVLVWSGS E A S+L C+SLLEKE AFSAPA + PT G Sbjct: 29 VEHRTSCRETSVRVPQGLMNGARPWRAATR--------------------------------------------------LAQLVLVWSGSEPEPALSILKDCVSLLEKEFAFSAPAFPAVPLLPTMPG 107
BLAST of mRNA_Ecto-sp13_S_contig99.21543.1 vs. uniprot
Match: D7FUL5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUL5_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 2.340e-8 Identity = 44/97 (45.36%), Postives = 50/97 (51.55%), Query Frame = 3 Query: 231 VAIGDATKLAELVLVWSGSIAEQAHSLLTRCISLLEKEVAFSAPASSPLQWPPTSLG--------------EFLCDG*SYWNNQHHEVQETPKVLFC 479 VA G ATKLAELVLVWS S E+A S+ C+SLLEKE A SA SSPL T+ G CDG S W E+Q + FC Sbjct: 74 VASGAATKLAELVLVWSVSKPERALSIARTCVSLLEKEDAHSASGSSPLXXXSTAPGPGRSSCLNAIVVALSETCDGKS-WYTSTKELQ-LASLGFC 168 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig99.21543.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig99.21543.1 >prot_Ecto-sp13_S_contig99.21543.1 ID=prot_Ecto-sp13_S_contig99.21543.1|Name=mRNA_Ecto-sp13_S_contig99.21543.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=62bp MERDIGSGTARPDKWASVVTSGDAVKLAELVLLSSGSSLRLFAGDEACIFback to top mRNA from alignment at Ecto-sp13_S_contig99:32100..33909- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig99.21543.1 ID=mRNA_Ecto-sp13_S_contig99.21543.1|Name=mRNA_Ecto-sp13_S_contig99.21543.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=1810bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99:32100..33909- (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig99:32100..33909- >mRNA_Ecto-sp13_S_contig99.21543.1 ID=mRNA_Ecto-sp13_S_contig99.21543.1|Name=mRNA_Ecto-sp13_S_contig99.21543.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=186bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99:32100..33909- (Ectocarpus species13 EcNAP12_S_4_19m)back to top |