mRNA_Ecto-sp13_S_contig99.21540.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: D1J7B0_ECTSI (Uncharacterized protein Escp152 n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D1J7B0_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 3.830e-15 Identity = 38/40 (95.00%), Postives = 39/40 (97.50%), Query Frame = 1 Query: 1 LVEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEGP 120 LVEKSIIPVFSNLEDAQNLLITVLEEVN+PFQ RRKMEGP Sbjct: 288 LVEKSIIPVFSNLEDAQNLLITVLEEVNKPFQARRKMEGP 327
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A344PFC3_9PHAE (Uncharacterized protein n=1 Tax=Endarachne binghamiae TaxID=698476 RepID=A0A344PFC3_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 5.030e-12 Identity = 31/39 (79.49%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 4 VEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEGP 120 ++K+IIP+FSNLEDAQ+LLITVLEEVN+PFQVRRK+E P Sbjct: 281 IDKNIIPIFSNLEDAQDLLITVLEEVNQPFQVRRKVEKP 319
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A7T8G5F4_SCYLO (Uncharacterized protein n=2 Tax=Scytosiphon TaxID=27966 RepID=A0A7T8G5F4_SCYLO) HSP 1 Score: 64.7 bits (156), Expect = 4.480e-11 Identity = 29/39 (74.36%), Postives = 37/39 (94.87%), Query Frame = 1 Query: 4 VEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEGP 120 ++K+IIP+FS LEDAQ+LLITVLEE+N+PFQVRRK+E P Sbjct: 281 IDKNIIPIFSKLEDAQDLLITVLEEINQPFQVRRKVEKP 319
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A1I9LVA6_9PHAE (Uncharacterized protein n=2 Tax=Pleurocladia lacustris TaxID=246121 RepID=A0A1I9LVA6_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 2.130e-10 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 4 VEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEGP 120 V+K++IPVFSNLEDAQ+LLIT LEE+N+PFQV RK+E P Sbjct: 294 VDKNLIPVFSNLEDAQDLLITTLEEINQPFQVLRKVETP 332
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A5A4MIP9_9PHAE (Uncharacterized protein n=1 Tax=Hapterophycus canaliculatus TaxID=2567908 RepID=A0A5A4MIP9_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 2.130e-10 Identity = 28/37 (75.68%), Postives = 37/37 (100.00%), Query Frame = 1 Query: 4 VEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKME 114 ++K+IIP+FSN+EDAQ+LLIT+LEEVN+PFQVRRK+E Sbjct: 279 IDKNIIPIFSNVEDAQDLLITLLEEVNQPFQVRRKVE 315
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A6B7EYX5_9PHAE (Uncharacterized protein n=1 Tax=Cladosiphon okamuranus TaxID=309737 RepID=A0A6B7EYX5_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 3.980e-10 Identity = 28/37 (75.68%), Postives = 37/37 (100.00%), Query Frame = 1 Query: 4 VEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKME 114 V+K+IIPVFS+LEDAQ+LLIT+L+E+N+PFQVRRK+E Sbjct: 357 VDKNIIPVFSSLEDAQDLLITILDEINQPFQVRRKIE 393
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A8F0JY34_9PHAE (Uncharacterized protein n=1 Tax=Pseudochorda nagaii TaxID=74379 RepID=A0A8F0JY34_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 3.890e-7 Identity = 25/39 (64.10%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 1 LVEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEG 117 L+ K+IIPVFS+LEDAQ+LL+TVLEE+ EP+Q+ R++E Sbjct: 302 LLSKNIIPVFSSLEDAQDLLLTVLEEILEPYQLLREIES 340
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A0R6M0B1_UNDPI (Uncharacterized protein n=1 Tax=Undaria pinnatifida TaxID=74381 RepID=A0A0R6M0B1_UNDPI) HSP 1 Score: 53.1 bits (126), Expect = 5.320e-7 Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 1 Query: 1 LVEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEGP 120 L+ K+IIP+FSNLEDAQ+LLI VLEE+ EPF+ R +E P Sbjct: 309 LLSKNIIPIFSNLEDAQDLLIVVLEELLEPFKTIRFIENP 348
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A8F0JZY5_9PHAE (Uncharacterized protein n=1 Tax=Egregia menziesii TaxID=105409 RepID=A0A8F0JZY5_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 7.270e-7 Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 1 Query: 1 LVEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEG 117 LV K+IIPVFSNLE+AQ+LLITVLEE+ EPF+ R +E Sbjct: 309 LVSKNIIPVFSNLEEAQDLLITVLEELLEPFKKIRSIEN 347
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Match: A0A8F0F6Z1_AKKLU (Uncharacterized protein n=1 Tax=Akkesiphycus lubricus TaxID=3022 RepID=A0A8F0F6Z1_AKKLU) HSP 1 Score: 52.0 bits (123), Expect = 1.360e-6 Identity = 24/39 (61.54%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 1 LVEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEG 117 L+ K+IIPVFS+L+DAQ+LL+TVLEE+ EP+Q+ R++E Sbjct: 314 LLSKNIIPVFSSLDDAQDLLLTVLEEILEPYQLIREIES 352 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig99.21540.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 15 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig99.21540.1 >prot_Ecto-sp13_S_contig99.21540.1 ID=prot_Ecto-sp13_S_contig99.21540.1|Name=mRNA_Ecto-sp13_S_contig99.21540.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=40bp LVEKSIIPVFSNLEDAQNLLITVLEEVNEPFQVRRKMEGPback to top mRNA from alignment at Ecto-sp13_S_contig99:163..282+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig99.21540.1 ID=mRNA_Ecto-sp13_S_contig99.21540.1|Name=mRNA_Ecto-sp13_S_contig99.21540.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=120bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99:163..282+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig99:163..282+ >mRNA_Ecto-sp13_S_contig99.21540.1 ID=mRNA_Ecto-sp13_S_contig99.21540.1|Name=mRNA_Ecto-sp13_S_contig99.21540.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=120bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99:163..282+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |