mRNA_Ecto-sp13_S_contig9859.21501.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig9859.21501.1 vs. uniprot
Match: A0A6H5J5U8_9PHAE (ABC protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J5U8_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 2.430e-11 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 2 Query: 107 VRRSTGSSVAHSTQLMMTLTIGTVIGLVFAWQIG 208 VRRSTGS+VAHSTQLMMTLTIGTVIGLVFAWQIG Sbjct: 722 VRRSTGSNVAHSTQLMMTLTIGTVIGLVFAWQIG 755
BLAST of mRNA_Ecto-sp13_S_contig9859.21501.1 vs. uniprot
Match: D7FHL4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHL4_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 8.540e-11 Identity = 32/34 (94.12%), Postives = 34/34 (100.00%), Query Frame = 2 Query: 107 VRRSTGSSVAHSTQLMMTLTIGTVIGLVFAWQIG 208 VRRSTGS+VAHSTQL+MTLTIGTVIGLVFAWQIG Sbjct: 740 VRRSTGSNVAHSTQLIMTLTIGTVIGLVFAWQIG 773
BLAST of mRNA_Ecto-sp13_S_contig9859.21501.1 vs. uniprot
Match: D7FHL1_ECTSI (ATP-binding cassette, sub-family B (MDR/TAP), member 1A n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHL1_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 1.740e-8 Identity = 26/34 (76.47%), Postives = 32/34 (94.12%), Query Frame = 2 Query: 107 VRRSTGSSVAHSTQLMMTLTIGTVIGLVFAWQIG 208 VR++TG +VAH+TQLMMTLT+GT+IGL FAWQIG Sbjct: 828 VRKATGGNVAHATQLMMTLTVGTLIGLAFAWQIG 861 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig9859.21501.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig9859.21501.1 >prot_Ecto-sp13_S_contig9859.21501.1 ID=prot_Ecto-sp13_S_contig9859.21501.1|Name=mRNA_Ecto-sp13_S_contig9859.21501.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=70bp TTSRGSIRNPPRWESLPLVLSQKPPWDASRCVSSPGAEIDREQRCPLDPAback to top mRNA from alignment at Ecto-sp13_S_contig9859:734..1798+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig9859.21501.1 ID=mRNA_Ecto-sp13_S_contig9859.21501.1|Name=mRNA_Ecto-sp13_S_contig9859.21501.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=1065bp|location=Sequence derived from alignment at Ecto-sp13_S_contig9859:734..1798+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig9859:734..1798+ >mRNA_Ecto-sp13_S_contig9859.21501.1 ID=mRNA_Ecto-sp13_S_contig9859.21501.1|Name=mRNA_Ecto-sp13_S_contig9859.21501.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=210bp|location=Sequence derived from alignment at Ecto-sp13_S_contig9859:734..1798+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |