mRNA_Ecto-sp13_S_contig9857.21500.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig9857.21500.1 vs. uniprot
Match: D7G0C3_ECTSI (PKS_ER domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0C3_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 6.650e-6 Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = -3 Query: 1 QASFLATTSTAEALCLSLGADVVVNYR 81
+ASFLATTSTAEALCLSLGADVVVNYR
Sbjct: 177 KASFLATTSTAEALCLSLGADVVVNYR 203
BLAST of mRNA_Ecto-sp13_S_contig9857.21500.1 vs. uniprot
Match: A0A6H5K1Q1_9PHAE (PKS_ER domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1Q1_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 8.440e-6 Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = -3 Query: 1 QASFLATTSTAEALCLSLGADVVVNYR 81
+ASFLATTSTAEALCLSLGADVVVNYR
Sbjct: 174 KASFLATTSTAEALCLSLGADVVVNYR 200 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig9857.21500.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig9857.21500.1 >prot_Ecto-sp13_S_contig9857.21500.1 ID=prot_Ecto-sp13_S_contig9857.21500.1|Name=mRNA_Ecto-sp13_S_contig9857.21500.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=100bp MKPVVGGTSDTRGYAAHRCLSYSNANNKEELNHARTRHHPWQLRLAPFHGback to top mRNA from alignment at Ecto-sp13_S_contig9857:686..1056+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig9857.21500.1 ID=mRNA_Ecto-sp13_S_contig9857.21500.1|Name=mRNA_Ecto-sp13_S_contig9857.21500.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=371bp|location=Sequence derived from alignment at Ecto-sp13_S_contig9857:686..1056+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig9857:686..1056+ >mRNA_Ecto-sp13_S_contig9857.21500.1 ID=mRNA_Ecto-sp13_S_contig9857.21500.1|Name=mRNA_Ecto-sp13_S_contig9857.21500.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=300bp|location=Sequence derived from alignment at Ecto-sp13_S_contig9857:686..1056+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |