mRNA_Ecto-sp13_S_contig10221.245.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig10221.245.1 vs. uniprot
Match: D7FUS3_ECTSI (PARP catalytic domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUS3_ECTSI) HSP 1 Score: 53.9 bits (128), Expect = 2.660e-6 Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = -1 Query: 207 KRLEEELKQNWPPRSRYADEEEAEGD 284 KRLEEELKQNWPPRSRYADEEEAEGD Sbjct: 222 KRLEEELKQNWPPRSRYADEEEAEGD 247 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig10221.245.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig10221.245.1 >prot_Ecto-sp13_S_contig10221.245.1 ID=prot_Ecto-sp13_S_contig10221.245.1|Name=mRNA_Ecto-sp13_S_contig10221.245.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=93bp MARDSTAAAVLQAGVADLKTNCAAVNGPHVCRVKEDTPKAGMWCKHGDPAback to top mRNA from alignment at Ecto-sp13_S_contig10221:720..1477+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig10221.245.1 ID=mRNA_Ecto-sp13_S_contig10221.245.1|Name=mRNA_Ecto-sp13_S_contig10221.245.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=758bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10221:720..1477+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig10221:720..1477+ >mRNA_Ecto-sp13_S_contig10221.245.1 ID=mRNA_Ecto-sp13_S_contig10221.245.1|Name=mRNA_Ecto-sp13_S_contig10221.245.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=279bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10221:720..1477+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |