mRNA_Ecto-sp13_S_contig10211.235.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig10211.235.1 vs. uniprot
Match: D7G6U5_ECTSI (MFS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6U5_ECTSI) HSP 1 Score: 76.6 bits (187), Expect = 1.670e-14 Identity = 39/51 (76.47%), Postives = 41/51 (80.39%), Query Frame = 3 Query: 3 RRKMQRNGWSCAPGLLATVDHSASIVAAEELFCVENGPGFE*FVRALAAAV 155 RRKM R G +CAP LLATVDHSASIV AEELF VENGPG E F+RALA V Sbjct: 151 RRKMHRIGSTCAPDLLATVDHSASIVVAEELFSVENGPGLEQFLRALAEPV 201 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig10211.235.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig10211.235.1 >prot_Ecto-sp13_S_contig10211.235.1 ID=prot_Ecto-sp13_S_contig10211.235.1|Name=mRNA_Ecto-sp13_S_contig10211.235.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=39bp MQRNGWSCAPGLLATVDHSASIVAAEELFCVENGPGFE*back to top mRNA from alignment at Ecto-sp13_S_contig10211:411..660+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig10211.235.1 ID=mRNA_Ecto-sp13_S_contig10211.235.1|Name=mRNA_Ecto-sp13_S_contig10211.235.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=250bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10211:411..660+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig10211:411..660+ >mRNA_Ecto-sp13_S_contig10211.235.1 ID=mRNA_Ecto-sp13_S_contig10211.235.1|Name=mRNA_Ecto-sp13_S_contig10211.235.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=117bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10211:411..660+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |