mRNA_Ecto-sp13_S_contig102093.230.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig102093.230.1 vs. uniprot
Match: A0A6H5KW71_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW71_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 8.960e-13 Identity = 31/33 (93.94%), Postives = 31/33 (93.94%), Query Frame = 3 Query: 6 GCPKQPKYGVAGTKKSEFC*GHRKAGMVDVVNR 104 GCPKQPKYGVAGTKK EFC GHRKAGMVDVVNR Sbjct: 8 GCPKQPKYGVAGTKKREFCSGHRKAGMVDVVNR 40
BLAST of mRNA_Ecto-sp13_S_contig102093.230.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 7.640e-6 Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 3 Query: 9 CPKQPKYGVAGTKKSEFC*GHRKAGMVDVVNRRC 110 C K+P YGVAG+KK EFC H + GMV+V N+RC Sbjct: 9 CTKRPTYGVAGSKKREFCSQHARDGMVNVNNKRC 42
BLAST of mRNA_Ecto-sp13_S_contig102093.230.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 7.790e-6 Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 3 Query: 9 CPKQPKYGVAGTKKSEFC*GHRKAGMVDVVNRRC 110 C K+P YGVAG+KK EFC H + GMV+V N+RC Sbjct: 69 CTKRPTYGVAGSKKREFCSQHARDGMVNVNNKRC 102 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig102093.230.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig102093.230.1 >prot_Ecto-sp13_S_contig102093.230.1 ID=prot_Ecto-sp13_S_contig102093.230.1|Name=mRNA_Ecto-sp13_S_contig102093.230.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=67bp MVVVPSSPSMVLPARKRASFARDTGRPAWWTSSTEGAPTTVAASSQTMVSback to top mRNA from alignment at Ecto-sp13_S_contig102093:49..249+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig102093.230.1 ID=mRNA_Ecto-sp13_S_contig102093.230.1|Name=mRNA_Ecto-sp13_S_contig102093.230.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=201bp|location=Sequence derived from alignment at Ecto-sp13_S_contig102093:49..249+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig102093:49..249+ >mRNA_Ecto-sp13_S_contig102093.230.1 ID=mRNA_Ecto-sp13_S_contig102093.230.1|Name=mRNA_Ecto-sp13_S_contig102093.230.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=201bp|location=Sequence derived from alignment at Ecto-sp13_S_contig102093:49..249+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |