Homology
The following BLAST results are available for this feature:
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Property Name | Value |
Stop | 1 |
Start | 0 |
Model size | 184 |
Hectar predicted targeting category | other localisation |
Exons | 1 |
Ec32 ortholog description | Hypothetical protein |
Ec32 ortholog | Ec-17_000150.1 |
Cds size | 180 |
Relationships
The following UTR feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type | Position |
1681462505.848067-UTR-Ecto-sp13_S_contig10077:2218..2222 | 1681462505.848067-UTR-Ecto-sp13_S_contig10077:2218..2222 | Ectocarpus species13 EcNAP12_S_4_19m | UTR | Ecto-sp13_S_contig10077 2219..2222 - |
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type | Position |
1681462505.8621433-CDS-Ecto-sp13_S_contig10077:2222..2402 | 1681462505.8621433-CDS-Ecto-sp13_S_contig10077:2222..2402 | Ectocarpus species13 EcNAP12_S_4_19m | CDS | Ecto-sp13_S_contig10077 2223..2402 - |
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig10077.105.1 >prot_Ecto-sp13_S_contig10077.105.1 ID=prot_Ecto-sp13_S_contig10077.105.1|Name=mRNA_Ecto-sp13_S_contig10077.105.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=60bp
RQPLALVRSSDFRSCDFAFNFASLTRLPSFQKLTVGAHPDSVLCSTNPPR GTLRPLHTI* back to topmRNA from alignment at Ecto-sp13_S_contig10077:2219..2402- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below. >mRNA_Ecto-sp13_S_contig10077.105.1 ID=mRNA_Ecto-sp13_S_contig10077.105.1|Name=mRNA_Ecto-sp13_S_contig10077.105.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=184bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10077:2219..2402- (Ectocarpus species13 EcNAP12_S_4_19m) AGGCAACCGTTAGCACTCGTACGCTCAAGTGATTTCAGGAGCTGTGATTT
TGCTTTCAACTTTGCATCCTTGACCCGTCTACCTTCGTTTCAAAAACTCA
CCGTGGGGGCGCATCCTGACTCAGTCCTATGTTCAACAAACCCACCAAGG
GGCACTCTGCGGCCTCTTCATACAATCTGACAGA back to topCoding sequence (CDS) from alignment at Ecto-sp13_S_contig10077:2219..2402- >mRNA_Ecto-sp13_S_contig10077.105.1 ID=mRNA_Ecto-sp13_S_contig10077.105.1|Name=mRNA_Ecto-sp13_S_contig10077.105.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=180bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10077:2219..2402- (Ectocarpus species13 EcNAP12_S_4_19m) AGGCAACCGTTAGCACTCGTACGCTCAAGTGATTTCAGGAGCTGTGATTT TGCTTTCAACTTTGCATCCTTGACCCGTCTACCTTCGTTTCAAAAACTCA CCGTGGGGGCGCATCCTGACTCAGTCCTATGTTCAACAAACCCACCAAGG GGCACTCTGCGGCCTCTTCATACAATCTGA back to top
|