Homology
The following BLAST results are available for this feature:
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Property Name | Value |
Stop | 1 |
Start | 1 |
Model size | 170 |
Hectar predicted targeting category | no signal peptide or anchor |
Exons | 1 |
Ec32 ortholog description | Hypothetical protein |
Ec32 ortholog | Ec-15_002840.1 |
Cds size | 120 |
Relationships
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type | Position |
1681462504.6165698-CDS-Ecto-sp13_S_contig10064:5010..5130 | 1681462504.6165698-CDS-Ecto-sp13_S_contig10064:5010..5130 | Ectocarpus species13 EcNAP12_S_4_19m | CDS | Ecto-sp13_S_contig10064 5011..5130 + |
The following UTR feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type | Position |
1681462504.6266613-UTR-Ecto-sp13_S_contig10064:5130..5180 | 1681462504.6266613-UTR-Ecto-sp13_S_contig10064:5130..5180 | Ectocarpus species13 EcNAP12_S_4_19m | UTR | Ecto-sp13_S_contig10064 5131..5180 + |
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig10064.89.1 >prot_Ecto-sp13_S_contig10064.89.1 ID=prot_Ecto-sp13_S_contig10064.89.1|Name=mRNA_Ecto-sp13_S_contig10064.89.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=40bp
MTSGDFCSRAPGRLIRPTDPPQPNGFNPLVLGDAIQSKK* back to topmRNA from alignment at Ecto-sp13_S_contig10064:5011..5180+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below. >mRNA_Ecto-sp13_S_contig10064.89.1 ID=mRNA_Ecto-sp13_S_contig10064.89.1|Name=mRNA_Ecto-sp13_S_contig10064.89.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=170bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10064:5011..5180+ (Ectocarpus species13 EcNAP12_S_4_19m) ATGACCAGCGGCGATTTCTGTTCGCGCGCCCCTGGACGTCTGATCCGACC
TACCGATCCGCCGCAGCCGAATGGTTTTAATCCTTTGGTGCTTGGGGATG
CAATCCAATCCAAGAAATGAACAGATCCTCGTGGCTCGTCATGCTTCGGC
ACCTGACAGGCCAATCGGTC back to topCoding sequence (CDS) from alignment at Ecto-sp13_S_contig10064:5011..5180+ >mRNA_Ecto-sp13_S_contig10064.89.1 ID=mRNA_Ecto-sp13_S_contig10064.89.1|Name=mRNA_Ecto-sp13_S_contig10064.89.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=120bp|location=Sequence derived from alignment at Ecto-sp13_S_contig10064:5011..5180+ (Ectocarpus species13 EcNAP12_S_4_19m) ATGACCAGCGGCGATTTCTGTTCGCGCGCCCCTGGACGTCTGATCCGACC TACCGATCCGCCGCAGCCGAATGGTTTTAATCCTTTGGTGCTTGGGGATG CAATCCAATCCAAGAAATGA back to top
|