mRNA_Ecto-sp13_S_contig100479.73.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: D7G4U4_ECTSI (Phosphodiesterase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4U4_ECTSI) HSP 1 Score: 92.4 bits (228), Expect = 9.040e-21 Identity = 42/43 (97.67%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QGDKEA RGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS Sbjct: 681 QGDKEAARGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 723
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A835Z5P1_9STRA (Phosphodiesterase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z5P1_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 1.840e-13 Identity = 32/43 (74.42%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QGD E +GL +SPLCDR NL KSQCDFIDFIVRPCVT+FS Sbjct: 1759 QGDLERGQGLQISPLCDRAQGNLAKSQCDFIDFIVRPCVTMFS 1801
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: D8LTM6_ECTSI (Phosphodiesterase n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LTM6_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 1.470e-11 Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QGD EA +G+ VSPLC R N KSQCDF++F+VRPC T+FS Sbjct: 557 QGDLEAEKGVPVSPLCSREGHNQAKSQCDFVNFVVRPCATVFS 599
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A7S1CCP6_9STRA (Phosphodiesterase n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1CCP6_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 3.330e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QGD E RG+ +SPLCDRR+ NL KSQ FIDF+VRP +FS Sbjct: 695 QGDLERQRGMEISPLCDRRNHNLSKSQLGFIDFVVRPAFALFS 737
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A7S3XSN1_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XSN1_HETAK) HSP 1 Score: 60.8 bits (146), Expect = 6.990e-10 Identity = 26/43 (60.47%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QG +EA GL VSPLCD+ ++PKSQC+FIDF+VRPC F+ Sbjct: 76 QGAREARAGLPVSPLCDQAKVDIPKSQCNFIDFLVRPCFEPFA 118
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A7S3XSI7_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XSI7_HETAK) HSP 1 Score: 61.2 bits (147), Expect = 8.160e-10 Identity = 27/44 (61.36%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRR-DQNLPKSQCDFIDFIVRPCVTIFS 129 QGD E RG+ +SPLCDR N KSQCDF+DF+VRPC+ FS Sbjct: 280 QGDAERRRGVPISPLCDRHAGGNFAKSQCDFVDFVVRPCLVPFS 323
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A7S1C309_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1C309_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 1.400e-8 Identity = 26/37 (70.27%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRP 111 QGD+E GLAVSPLCDR D NLPK+Q FIDF+V P Sbjct: 265 QGDRERELGLAVSPLCDRGDVNLPKAQLGFIDFVVLP 301
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A7S1C4N6_9STRA (Hypothetical protein n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1C4N6_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 3.630e-8 Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QGDKE GL +SPLCDR + +L KSQ FI+F+VRPC FS Sbjct: 836 QGDKERVLGLPISPLCDRDNFDLAKSQQGFIEFVVRPCFEPFS 878
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: A0A7S3XXI8_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XXI8_HETAK) HSP 1 Score: 55.8 bits (133), Expect = 6.480e-8 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFS 129 QG +E GL +S LCDR LPKSQCDFI+F+V+PC+ FS Sbjct: 151 QGAREKEEGLPISFLCDRATVVLPKSQCDFINFLVKPCLGPFS 193
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Match: E9GVS7_DAPPU (PDEase domain-containing protein (Fragment) n=1 Tax=Daphnia pulex TaxID=6669 RepID=E9GVS7_DAPPU) HSP 1 Score: 50.4 bits (119), Expect = 1.150e-6 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRP 111 QGD+E +GL VSP+CDR++ + KSQ FID+IV P Sbjct: 35 QGDREREQGLDVSPMCDRQNATIEKSQVGFIDYIVHP 71 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig100479.73.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig100479.73.1 >prot_Ecto-sp13_S_contig100479.73.1 ID=prot_Ecto-sp13_S_contig100479.73.1|Name=mRNA_Ecto-sp13_S_contig100479.73.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=43bp QGDKEATRGLAVSPLCDRRDQNLPKSQCDFIDFIVRPCVTIFSback to top mRNA from alignment at Ecto-sp13_S_contig100479:171..299- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig100479.73.1 ID=mRNA_Ecto-sp13_S_contig100479.73.1|Name=mRNA_Ecto-sp13_S_contig100479.73.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=129bp|location=Sequence derived from alignment at Ecto-sp13_S_contig100479:171..299- (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig100479:171..299- >mRNA_Ecto-sp13_S_contig100479.73.1 ID=mRNA_Ecto-sp13_S_contig100479.73.1|Name=mRNA_Ecto-sp13_S_contig100479.73.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=129bp|location=Sequence derived from alignment at Ecto-sp13_S_contig100479:171..299- (Ectocarpus species13 EcNAP12_S_4_19m)back to top |