mRNA_Ecto-sp13_S_contig100324.53.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: D7FJS7_ECTSI (MAP kinase phosphatase 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJS7_ECTSI) HSP 1 Score: 106 bits (264), Expect = 2.410e-26 Identity = 48/49 (97.96%), Postives = 49/49 (100.00%), Query Frame = 1 Query: 1 GRFNFLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 GRFNFLRLNFYDHRTEDCAWFMY+AFDFMKAAEEQRGRVLVHCVQGVSR Sbjct: 76 GRFNFLRLNFYDHRTEDCAWFMYKAFDFMKAAEEQRGRVLVHCVQGVSR 124
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A6H5L2L8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2L8_9PHAE) HSP 1 Score: 107 bits (268), Expect = 4.810e-26 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1 Query: 1 GRFNFLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 GRFNFLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR Sbjct: 196 GRFNFLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 244
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A7S2V0L7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V0L7_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 4.940e-8 Identity = 24/45 (53.33%), Postives = 33/45 (73.33%), Query Frame = 1 Query: 13 FLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 +L N +D + ED F+YQ+FDF+++ E GRVLVHCV+GVSR Sbjct: 131 YLSFNLFDSKMEDITCFLYQSFDFIESCREAGGRVLVHCVEGVSR 175
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A7S2WVL7_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WVL7_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 5.470e-6 Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 1 Query: 13 FLRLNFYDHRT--EDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 + +LN YD + ED +WF+YQ D + + G+VLVHCVQGVSR Sbjct: 260 YTKLNMYDSKDGEEDISWFVYQVIDVIDQVRQAGGKVLVHCVQGVSR 306
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A498KLG7_MALDO (Uncharacterized protein n=7 Tax=Maleae TaxID=721813 RepID=A0A498KLG7_MALDO) HSP 1 Score: 49.3 bits (116), Expect = 1.920e-5 Identity = 22/38 (57.89%), Postives = 25/38 (65.79%), Query Frame = 1 Query: 34 DHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 D TED +Y FD+ + EQRGRVLVHC QGVSR Sbjct: 204 DSPTEDITSILYDVFDYFEDVREQRGRVLVHCCQGVSR 241
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A830HCY9_9CHLO (Uncharacterized protein n=1 Tax=Pycnococcus provasolii TaxID=41880 RepID=A0A830HCY9_9CHLO) HSP 1 Score: 47.8 bits (112), Expect = 6.700e-5 Identity = 24/49 (48.98%), Postives = 30/49 (61.22%), Query Frame = 1 Query: 1 GRFNFLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 G+ + L D ED A +Y FDF+++A RGRVLVHC QGVSR Sbjct: 259 GKLAYKTLWLQDSPGEDIASVLYPCFDFIESARASRGRVLVHCSQGVSR 307
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A1D6LHJ1_MAIZE (Protein-tyrosine-phosphatase MKP1 n=1 Tax=Zea mays TaxID=4577 RepID=A0A1D6LHJ1_MAIZE) HSP 1 Score: 47.8 bits (112), Expect = 6.730e-5 Identity = 21/38 (55.26%), Postives = 24/38 (63.16%), Query Frame = 1 Query: 34 DHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 D TED +Y FD+ + EQRGRV VHC QGVSR Sbjct: 199 DSPTEDITSILYDVFDYFEDVREQRGRVFVHCCQGVSR 236
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A4D9AMJ3_SALSN (Atypical dual specificity phosphatase n=6 Tax=Salvia TaxID=21880 RepID=A0A4D9AMJ3_SALSN) HSP 1 Score: 47.8 bits (112), Expect = 6.740e-5 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 34 DHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 D +ED +Y FD+ + +EQRGRVLVHC QGVSR Sbjct: 190 DCPSEDITSILYDVFDYFEDVQEQRGRVLVHCFQGVSR 227
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Match: A0A4D9C1F1_SALSN (Atypical dual specificity phosphatase n=1 Tax=Salvia splendens TaxID=180675 RepID=A0A4D9C1F1_SALSN) HSP 1 Score: 47.8 bits (112), Expect = 6.760e-5 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 34 DHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR 147 D +ED +Y FD+ + +EQRGRVLVHC QGVSR Sbjct: 207 DCPSEDITSILYDVFDYFEDVQEQRGRVLVHCFQGVSR 244 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig100324.53.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig100324.53.1 >prot_Ecto-sp13_S_contig100324.53.1 ID=prot_Ecto-sp13_S_contig100324.53.1|Name=mRNA_Ecto-sp13_S_contig100324.53.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=50bp GRFNFLRLNFYDHRTEDCAWFMYQAFDFMKAAEEQRGRVLVHCVQGVSR*back to top mRNA from alignment at Ecto-sp13_S_contig100324:325..474+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig100324.53.1 ID=mRNA_Ecto-sp13_S_contig100324.53.1|Name=mRNA_Ecto-sp13_S_contig100324.53.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=150bp|location=Sequence derived from alignment at Ecto-sp13_S_contig100324:325..474+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig100324:325..474+ >mRNA_Ecto-sp13_S_contig100324.53.1 ID=mRNA_Ecto-sp13_S_contig100324.53.1|Name=mRNA_Ecto-sp13_S_contig100324.53.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=150bp|location=Sequence derived from alignment at Ecto-sp13_S_contig100324:325..474+ (Ectocarpus species13 EcNAP12_S_4_19m)back to top |