Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a male
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 24..61 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..23 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 4..15 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 16..23 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..3 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..21
score: 0.584 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_M_contig92.17316.1 ID=prot_E-siliculosus-1a_M_contig92.17316.1|Name=mRNA_E-siliculosus-1a_M_contig92.17316.1|organism=Ectocarpus siliculosus Ec864m_EcPH12_78m male|type=polypeptide|length=62bp
MAGSGLLRLLLFLFTRDELHTRAGPTCRWRQSKDTSASPDSRISAYTASN
SSVHGFFPVTE* back to top
|