Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a female
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 41..61 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..40 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 62..106 |
None | No IPR available | TMHMM | TMhelix | | coord: 30..52 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_F_contig10244.218.1 ID=prot_E-siliculosus-1a_F_contig10244.218.1|Name=mRNA_E-siliculosus-1a_F_contig10244.218.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=106bp CYLRCCNRLCFSEMDRNQWVPDPNRTKQILLLARLPLLLPLPLPLALLHP LLQLPLLLTLLQLPTPRWIETSGYPIQVAPNSKMKKPGGIGSSFRPKSGR RKRPMP back to top
|