prot_E-siliculosus-1a_F_contig10192.182.1 (polypeptide) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: D7G017_ECTSI (Tub domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G017_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 3.240e-21 Identity = 43/44 (97.73%), Postives = 44/44 (100.00%), Query Frame = 0 Query: 2 EGSDIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPEK 45 EGSDIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLV+PEK Sbjct: 456 EGSDIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVSPEK 499
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A8K1C842_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C842_PYTOL) HSP 1 Score: 68.6 bits (166), Expect = 2.940e-12 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPEK 45 D++ FET PSWNE L AWTLNFNGRVK+PSKKNFL+ E+ Sbjct: 549 DLLVFETRKPSWNEELGAWTLNFNGRVKLPSKKNFLIVAEE 589
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A2D4C602_PYTIN (Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4C602_PYTIN) HSP 1 Score: 67.4 bits (163), Expect = 7.460e-12 Identity = 29/40 (72.50%), Postives = 33/40 (82.50%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPE 44 D++TFET PSWNE L AWTLNF GRVK+ SKKNFL+ PE Sbjct: 391 DLLTFETKKPSWNEELGAWTLNFQGRVKMASKKNFLIVPE 430
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A836CGA0_9STRA (Tubby C-terminal-like domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CGA0_9STRA) HSP 1 Score: 67.4 bits (163), Expect = 7.480e-12 Identity = 30/42 (71.43%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 4 SDIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPEK 45 SDI+ ET PSWN L AW LNFNGRV+IPSKKNFL APE+ Sbjct: 378 SDIMVLETKRPSWNPALEAWVLNFNGRVRIPSKKNFLGAPER 419
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A5D6XV38_9STRA (PDZ domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XV38_9STRA) HSP 1 Score: 66.6 bits (161), Expect = 1.400e-11 Identity = 28/44 (63.64%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPEKVSS 48 D++TFET P+WN+ L AWTLNF+GRVK+ SKKNFL+ PE+ S+ Sbjct: 653 DLLTFETKKPAWNDELGAWTLNFHGRVKLASKKNFLLVPEQGSA 696
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: K3X577_GLOUD (PDZ domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X577_GLOUD) HSP 1 Score: 65.5 bits (158), Expect = 3.580e-11 Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPEK 45 D++TFET P+WN+ L AWTLNF+GRVK+ SKKNFL+ PE+ Sbjct: 665 DLLTFETKKPAWNDELGAWTLNFHGRVKLASKKNFLLVPEQ 705
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A2R5GUZ5_9STRA (Tubby protein-like n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GUZ5_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 1.250e-10 Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 1 QEGSDIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPE 44 +E S+++ F+TL P WNE L AWTLNFN RVK+ SKKNF++ P+ Sbjct: 575 EELSELLEFDTLKPQWNEELQAWTLNFNSRVKMASKKNFMLVPQ 618
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A662YJH7_9STRA (PDZ domain-containing protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662YJH7_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 1.250e-10 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLV 41 D++TFET PSWNE L AWTLNF GRVK+ SKKNFL+ Sbjct: 637 DLLTFETKKPSWNETLSAWTLNFQGRVKVASKKNFLL 673
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A6V1UG96_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1UG96_HETAK) HSP 1 Score: 63.5 bits (153), Expect = 1.690e-10 Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPE 44 D++ FET P WNE + AWTLNFNGRVKIPSKKNF + E Sbjct: 330 DLMIFETKRPVWNEQIQAWTLNFNGRVKIPSKKNFFIQAE 369
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Match: A0A7S1TR98_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1TR98_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 5.970e-10 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 5 DIITFETLSPSWNEVLHAWTLNFNGRVKIPSKKNFLVAPEK 45 D++ ET P+W+E L AWTLNF GRVK SKKNFL+APEK Sbjct: 613 DLLVLETKRPAWSEELKAWTLNFEGRVKRASKKNFLIAPEK 653 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10192.182.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a female
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_F_contig10192.182.1 ID=prot_E-siliculosus-1a_F_contig10192.182.1|Name=mRNA_E-siliculosus-1a_F_contig10192.182.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=49bpback to top |