mRNA_E-siliculosus-1a_F_contig11011.701.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: D7G6Q2_ECTSI (DDE Tnp4 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G6Q2_ECTSI) HSP 1 Score: 94.4 bits (233), Expect = 1.570e-21 Identity = 45/54 (83.33%), Postives = 49/54 (90.74%), Query Frame = 1 Query: 1 ELVAATTLPGVASMPNFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 ELVAATTLPGVASMPNFM+VIG FDFWEL RFEKRHFRLL+E ++LP IEIYR Sbjct: 52 ELVAATTLPGVASMPNFMDVIGGFDFWELTRFEKRHFRLLVELLELPEMIEIYR 105
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5KAA1_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAA1_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 4.450e-8 Identity = 32/54 (59.26%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 1 ELVAATTLPGVASMPNFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 ELVA T L GV +FMEV+G FDF E+ RFEK HFR LL ++LP E+EI R Sbjct: 52 ELVAPTQLGGVRY--DFMEVLGGFDFKEVFRFEKSHFRQLLAALELPPELEIRR 103
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5KC62_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KC62_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 6.750e-7 Identity = 29/54 (53.70%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 ELVAATTLPGVASMPNFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 ELVA T L G+ +FMEV+G FDF EL+RFE+ HFR LL ++ P E I R Sbjct: 52 ELVAPTQLDGMRY--DFMEVLGGFDFKELLRFEQPHFRRLLAALEFPPEFVISR 103
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5K3T4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3T4_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 1.330e-6 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 1 ELVAATTLPGVASMPNFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEI 156 ELVA T L GV +FMEV+G FDF EL+RFEK HFR L+ ++LP E I Sbjct: 52 ELVAPTHLDGVRY--DFMEVLGGFDFKELLRFEKPHFRRLVAALELPPEFVI 101
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5K122_9PHAE (DDE Tnp4 domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K122_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 3.590e-6 Identity = 30/54 (55.56%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 ELVAATTLPGVASMPNFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 ELVA T L G+ +FMEV+ FDF EL+RFEK HFR LL ++LP E I R Sbjct: 52 ELVAPTQLDGMRY--DFMEVLDGFDFKELLRFEKPHFRRLLTALELPPEFVISR 103
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5KDJ8_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDJ8_9PHAE) HSP 1 Score: 48.9 bits (115), Expect = 3.180e-5 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 46 NFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 +FMEV+G FDF EL+RFEK HFR LL ++LP E I R Sbjct: 4 DFMEVLGGFDFKELLRFEKPHFRRLLAALELPPEFVISR 42
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5JTB7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTB7_9PHAE) HSP 1 Score: 46.2 bits (108), Expect = 3.330e-5 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 46 NFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 +FMEV+G FDF EL+RFEK +FR LL ++LP E I R Sbjct: 36 DFMEVLGGFDFKELLRFEKPNFRRLLAALELPPEFVISR 74
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Match: A0A6H5KNF3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KNF3_9PHAE) HSP 1 Score: 46.6 bits (109), Expect = 3.920e-5 Identity = 23/39 (58.97%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 46 NFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIEIYR 162 +FM V+G FDF EL+RFEK HFR LL ++LP E I R Sbjct: 60 DFMAVLGGFDFKELLRFEKPHFRRLLAALELPPEFVISR 98 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig11011.701.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 8 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig11011.701.1 >prot_E-siliculosus-1a_F_contig11011.701.1 ID=prot_E-siliculosus-1a_F_contig11011.701.1|Name=mRNA_E-siliculosus-1a_F_contig11011.701.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=55bp ELVAATTLPGVASMPNFMEVIGDFDFWELIRFEKRHFRLLLEFVQLPMEIback to top mRNA from alignment at E-siliculosus-1a_F_contig11011:1623..1787+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig11011.701.1 ID=mRNA_E-siliculosus-1a_F_contig11011.701.1|Name=mRNA_E-siliculosus-1a_F_contig11011.701.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=165bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig11011:1623..1787+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig11011:1623..1787+ >mRNA_E-siliculosus-1a_F_contig11011.701.1 ID=mRNA_E-siliculosus-1a_F_contig11011.701.1|Name=mRNA_E-siliculosus-1a_F_contig11011.701.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=330bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig11011:1623..1787+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |