mRNA_E-siliculosus-1a_F_contig1071.509.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig1071.509.1 vs. uniprot
Match: D7FI79_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI79_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 6.190e-8 Identity = 29/29 (100.00%), Postives = 29/29 (100.00%), Query Frame = -1 Query: 714 AGDTGMGWFEPLAGALRERALQAFEEDVF 800 AGDTGMGWFEPLAGALRERALQAFEEDVF Sbjct: 3248 AGDTGMGWFEPLAGALRERALQAFEEDVF 3276
BLAST of mRNA_E-siliculosus-1a_F_contig1071.509.1 vs. uniprot
Match: A0A6H5JKW6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKW6_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 1.960e-7 Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = -1 Query: 714 AGDTGMGWFEPLAGALRERALQAFEEDVF 800 AGDTGMGWFEPLAGALRERAL+AFEEDVF Sbjct: 2134 AGDTGMGWFEPLAGALRERALRAFEEDVF 2162 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig1071.509.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig1071.509.1 >prot_E-siliculosus-1a_F_contig1071.509.1 ID=prot_E-siliculosus-1a_F_contig1071.509.1|Name=mRNA_E-siliculosus-1a_F_contig1071.509.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=140bp LFLLLCSHEQKIFSSVQLTRTPFAATSQLPRTHTIRGHCHCGSTAITQSLback to top mRNA from alignment at E-siliculosus-1a_F_contig1071:13662..14461+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig1071.509.1 ID=mRNA_E-siliculosus-1a_F_contig1071.509.1|Name=mRNA_E-siliculosus-1a_F_contig1071.509.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=800bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig1071:13662..14461+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig1071:13662..14461+ >mRNA_E-siliculosus-1a_F_contig1071.509.1 ID=mRNA_E-siliculosus-1a_F_contig1071.509.1|Name=mRNA_E-siliculosus-1a_F_contig1071.509.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=840bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig1071:13662..14461+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |