mRNA_E-siliculosus-1a_F_contig10365.288.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5JUC1_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUC1_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 2.090e-9 Identity = 29/43 (67.44%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQG 129 GKY EAEPLY+RCQ ++ LGP+HPSLA+TL+NRA +L AQG Sbjct: 187 GKYSEAEPLYDRCQAMKGKALGPEHPSLAATLNNRAELLRAQG 229
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5JJK0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJK0_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 2.350e-9 Identity = 29/42 (69.05%), Postives = 35/42 (83.33%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY +AEPLYERCQ I E LGP+HP +A+TL+NRAG+L AQ Sbjct: 941 GKYTDAEPLYERCQAIYEKRLGPEHPYVATTLNNRAGLLEAQ 982
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5K3K8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3K8_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 6.620e-9 Identity = 27/42 (64.29%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY+EAEPLYER Q I+E VLG +HP +AS+L+NR +L AQ Sbjct: 19 GKYMEAEPLYERSQAIQEKVLGLEHPDVASSLNNRVELLRAQ 60
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: UPI0013D29528 (tetratricopeptide repeat protein n=1 Tax=Desulfobacter hydrogenophilus TaxID=2291 RepID=UPI0013D29528) HSP 1 Score: 58.5 bits (140), Expect = 2.450e-8 Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGM 114 GKY EAEPLY+R I E VLGPDHPS+A+TL+N AG+ Sbjct: 5 GKYEEAEPLYQRALKIRETVLGPDHPSVATTLNNLAGL 42
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5KIY6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIY6_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 5.910e-8 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY +AEPL ER QTI E VLGP+HP +A +L+NRAG+L AQ Sbjct: 499 GKYDDAEPLNERSQTIREKVLGPEHPDVAQSLNNRAGLLEAQ 540
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5KXS7_9PHAE (NB-ARC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXS7_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 6.220e-8 Identity = 27/42 (64.29%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY EAEPLYER Q I+ENVLGP+HP + ++L+NRA +L Q Sbjct: 661 GKYAEAEPLYERSQAIQENVLGPEHPDVGTSLNNRALLLEKQ 702
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5K5H9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5H9_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 8.110e-8 Identity = 27/42 (64.29%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY EAEPLYER Q I E LGP+HP++A+ L+NRAG+L Q Sbjct: 31 GKYAEAEPLYERWQAIFETALGPEHPNVATALNNRAGLLEDQ 72
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: D7G722_ECTSI (NB-ARC and TPR repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G722_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 2.290e-7 Identity = 26/39 (66.67%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGML 117 GKY EAEPLYER I+E VLGP+HP +A++LDNRA +L Sbjct: 694 GKYAEAEPLYERSLAIQEKVLGPEHPDVATSLDNRASLL 732
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: A0A6H5JPL8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPL8_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 2.480e-7 Identity = 28/42 (66.67%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY EA PLY RCQ I+E VLGPDHP LA+TL N A +L Q Sbjct: 22 GKYTEAGPLYARCQAIQEAVLGPDHPRLATTLGNWAALLYEQ 63
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Match: D7G6W2_ECTSI (NB-ARC and TPR repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6W2_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 3.140e-7 Identity = 27/42 (64.29%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 1 GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQ 126 GKY EA+PLY R I EN LGPDHP+LA+ L+NRAG+L +Q Sbjct: 613 GKYAEADPLYLRAIEIGENTLGPDHPALATQLNNRAGLLGSQ 654 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10365.288.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 23 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig10365.288.1 >prot_E-siliculosus-1a_F_contig10365.288.1 ID=prot_E-siliculosus-1a_F_contig10365.288.1|Name=mRNA_E-siliculosus-1a_F_contig10365.288.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=186bp GKYVEAEPLYERCQTIEENVLGPDHPSLASTLDNRAGMLSAQGKFAEAQPback to top mRNA from alignment at E-siliculosus-1a_F_contig10365:1129..2539+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig10365.288.1 ID=mRNA_E-siliculosus-1a_F_contig10365.288.1|Name=mRNA_E-siliculosus-1a_F_contig10365.288.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=1411bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10365:1129..2539+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig10365:1129..2539+ >mRNA_E-siliculosus-1a_F_contig10365.288.1 ID=mRNA_E-siliculosus-1a_F_contig10365.288.1|Name=mRNA_E-siliculosus-1a_F_contig10365.288.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=1116bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10365:1129..2539+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |