mRNA_E-siliculosus-1a_F_contig10255.223.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10255.223.1 vs. uniprot
Match: A0A6H5KAA4_9PHAE (Uncharacterized protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAA4_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 3.960e-13 Identity = 35/39 (89.74%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 PHARLAADAQQQQEGFGHPLRVSLALLARKTPPFTTTHV 118 PHARLAADAQ QQEGFGHPLRVSLALLARKT PF TTH Sbjct: 41 PHARLAADAQ-QQEGFGHPLRVSLALLARKTAPFATTHA 78
BLAST of mRNA_E-siliculosus-1a_F_contig10255.223.1 vs. uniprot
Match: A0A6H5JES7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JES7_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 7.050e-8 Identity = 33/49 (67.35%), Postives = 36/49 (73.47%), Query Frame = 2 Query: 5 HARLAADAQQQQEGFGHPLRVSLALLARKTPPFTTTHV*AKACRGARGR 151 +ARLAA A QQEG G PLRVSLALLARKTPP H AK CRG+ G+ Sbjct: 42 YARLAAGAP-QQEGIG-PLRVSLALLARKTPPLAMGHAYAKPCRGSEGK 88
BLAST of mRNA_E-siliculosus-1a_F_contig10255.223.1 vs. uniprot
Match: A0A6H5KJA1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJA1_9PHAE) HSP 1 Score: 50.4 bits (119), Expect = 8.720e-6 Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = -1 Query: 3 GSFWRAGLDSPSRDDRNLLAAAAHPPRGVRV 95 G+ +GLDSPSRDDRNLLAAA HPPRGVRV Sbjct: 6 GAQSNSGLDSPSRDDRNLLAAA-HPPRGVRV 35
BLAST of mRNA_E-siliculosus-1a_F_contig10255.223.1 vs. uniprot
Match: A0A6H5JY20_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JY20_9PHAE) HSP 1 Score: 48.9 bits (115), Expect = 4.860e-5 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = -2 Query: 5 SEGGGLSGEQG*THPQGMTETFLLLLRIRREACV 106 SEGGGLS EQG THPQG T+TFLL R RREACV Sbjct: 4 SEGGGLSSEQGWTHPQG-TDTFLLR-RTRREACV 35
BLAST of mRNA_E-siliculosus-1a_F_contig10255.223.1 vs. uniprot
Match: A0A6H5KA44_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KA44_9PHAE) HSP 1 Score: 49.7 bits (117), Expect = 5.420e-5 Identity = 24/26 (92.31%), Postives = 25/26 (96.15%), Query Frame = -1 Query: 3 AGLDSPSRDDRNLLAAAAHPPRGVRV 80 +GLDSPSRDDRNLLAAA HPPRGVRV Sbjct: 62 SGLDSPSRDDRNLLAAA-HPPRGVRV 86 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10255.223.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig10255.223.1 >prot_E-siliculosus-1a_F_contig10255.223.1 ID=prot_E-siliculosus-1a_F_contig10255.223.1|Name=mRNA_E-siliculosus-1a_F_contig10255.223.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=129bp TTRTPRGGCAAAARRFRSSLEGESSPARQKDPPLHYNPCLSKSLSRSEGKback to top mRNA from alignment at E-siliculosus-1a_F_contig10255:6..499+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig10255.223.1 ID=mRNA_E-siliculosus-1a_F_contig10255.223.1|Name=mRNA_E-siliculosus-1a_F_contig10255.223.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=494bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10255:6..499+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig10255:6..499+ >mRNA_E-siliculosus-1a_F_contig10255.223.1 ID=mRNA_E-siliculosus-1a_F_contig10255.223.1|Name=mRNA_E-siliculosus-1a_F_contig10255.223.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=774bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10255:6..499+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |