mRNA_E-siliculosus-1a_F_contig10215.204.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10215.204.1 vs. uniprot
Match: A0A6H5JGM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGM7_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 1.710e-14 Identity = 29/49 (59.18%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 4 GDPLRVGECICTRPDCVGGMYKKFKRRREKEENGSRNYMVVGQASPMGR 150 GDPL+ GECIC R DCV +Y+++K RR++EE G+ + MV+GQ SPMGR Sbjct: 74 GDPLKAGECICRRADCVVNLYQRYKGRRQREEKGALHTMVIGQRSPMGR 122
BLAST of mRNA_E-siliculosus-1a_F_contig10215.204.1 vs. uniprot
Match: D7FTC1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTC1_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 4.360e-11 Identity = 31/34 (91.18%), Postives = 31/34 (91.18%), Query Frame = 3 Query: 6 RPSQGGRVHLYTARLRRRDVQKVQEAPREGRKRV 107 RPSQ GRVHLYTARLR RDVQKVQEAPREG KRV Sbjct: 69 RPSQSGRVHLYTARLRWRDVQKVQEAPREGGKRV 102
BLAST of mRNA_E-siliculosus-1a_F_contig10215.204.1 vs. uniprot
Match: A0A6H5KE39_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KE39_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 6.100e-7 Identity = 19/24 (79.17%), Postives = 22/24 (91.67%), Query Frame = 1 Query: 1 QGDPLRVGECICTRPDCVGGMYKK 72 QGDPL+VGECICTRPDC GG+ +K Sbjct: 72 QGDPLKVGECICTRPDCAGGIVQK 95 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10215.204.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig10215.204.1 >prot_E-siliculosus-1a_F_contig10215.204.1 ID=prot_E-siliculosus-1a_F_contig10215.204.1|Name=mRNA_E-siliculosus-1a_F_contig10215.204.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=59bp QGDPLRVGECICTRPDCVGGMYKKFKRRREKEENGSRNYMVVGQASPMGRback to top mRNA from alignment at E-siliculosus-1a_F_contig10215:2326..2502- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig10215.204.1 ID=mRNA_E-siliculosus-1a_F_contig10215.204.1|Name=mRNA_E-siliculosus-1a_F_contig10215.204.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=177bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10215:2326..2502- (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig10215:2326..2502- >mRNA_E-siliculosus-1a_F_contig10215.204.1 ID=mRNA_E-siliculosus-1a_F_contig10215.204.1|Name=mRNA_E-siliculosus-1a_F_contig10215.204.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=354bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10215:2326..2502- (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |