mRNA_E-siliculosus-1a_F_contig10098.116.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10098.116.1 vs. uniprot
Match: D7G5U5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5U5_ECTSI) HSP 1 Score: 95.1 bits (235), Expect = 7.140e-21 Identity = 41/71 (57.75%), Postives = 49/71 (69.01%), Query Frame = 2 Query: 521 GSSLRGVDGSHFERGKDYDPSEGVDCPIPLGWGLLWHGLYVHGGADCSIPWHARLHMYLRVSGCSDAVTGK 733 G+ LR VDGSH + K+Y+ V+C IP GWGLLWHGL VHGG C+ W ARLH++LR GC A TGK Sbjct: 80 GTILRIVDGSHLDVHKNYEQGRAVECQIPRGWGLLWHGLSVHGGDGCTAAWLARLHIFLRALGCPQAATGK 150
BLAST of mRNA_E-siliculosus-1a_F_contig10098.116.1 vs. uniprot
Match: D7G604_ECTSI (Uncharacterized protein n=3 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G604_ECTSI) HSP 1 Score: 95.1 bits (235), Expect = 8.410e-20 Identity = 41/71 (57.75%), Postives = 49/71 (69.01%), Query Frame = 2 Query: 521 GSSLRGVDGSHFERGKDYDPSEGVDCPIPLGWGLLWHGLYVHGGADCSIPWHARLHMYLRVSGCSDAVTGK 733 G+ LR VDGSH + K+Y+ V+C IP GWGLLWHGL VHGG C+ W ARLH++LR GC A TGK Sbjct: 191 GTILRIVDGSHLDVHKNYEQGSAVECQIPRGWGLLWHGLSVHGGDGCTAAWLARLHIFLRALGCPQAATGK 261 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10098.116.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig10098.116.1 >prot_E-siliculosus-1a_F_contig10098.116.1 ID=prot_E-siliculosus-1a_F_contig10098.116.1|Name=mRNA_E-siliculosus-1a_F_contig10098.116.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=152bp MVPSVTVGVILIVAPPKWEIRCGTSYGLSTVARMIKSSWRRPRAWSASPMback to top mRNA from alignment at E-siliculosus-1a_F_contig10098:2..883- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig10098.116.1 ID=mRNA_E-siliculosus-1a_F_contig10098.116.1|Name=mRNA_E-siliculosus-1a_F_contig10098.116.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=882bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10098:2..883- (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig10098:2..883- >mRNA_E-siliculosus-1a_F_contig10098.116.1 ID=mRNA_E-siliculosus-1a_F_contig10098.116.1|Name=mRNA_E-siliculosus-1a_F_contig10098.116.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=912bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10098:2..883- (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |