mRNA_E_fasciculatus_S2_contig983.17840.1 (mRNA) Ectocarpus fasciculatus EfasUO2
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: PUB (domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YQA1_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 4.530e-16 Identity = 36/63 (57.14%), Postives = 42/63 (66.67%), Query Frame = 1 Query: 10 RLVSSSCDRLEDSTIAIRYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRE 198 R V+ S ED T A++YL N+ HP E KYR +KK N RF +EVWL PGIR F AIGFRE Sbjct: 12 RCVALSHANNEDPTTAVKYLINIAKHPQEGKYRVLKKQNSRFMNEVWLNPGIRGMFQAIGFRE 74
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: PUB (domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ99_ECTSI) HSP 1 Score: 73.6 bits (179), Expect = 4.880e-15 Identity = 32/63 (50.79%), Postives = 46/63 (73.02%), Query Frame = 1 Query: 10 RLVSSSCDRLEDSTIAIRYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRE 198 R V+ S + EDST+ ++YL NV+NHP + KYR +K N++F +EVWL G+R FLA+GFR+ Sbjct: 34 RCVALSRRQGEDSTVGVKYLRNVLNHPDDVKYRTLKISNKKFYTEVWLNSGMRGLFLALGFRK 96
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: Hypothetical (protein n=1 Tax=Grammatophora oceanica TaxID=210454 RepID=A0A7S1VQI1_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 1.410e-6 Identity = 23/48 (47.92%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 58 IRYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRED 201 ++YL N++ HP E KYRKI+ N++F +EVW R FLA GF+E+ Sbjct: 376 LKYLTNILRHPSERKYRKIRTANKKFYAEVW-NTAARGLFLAAGFKEE 422
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: UBX (domain-containing protein 6-like n=1 Tax=Phallusia mammillata TaxID=59560 RepID=A0A6F9DWD2_9ASCI) HSP 1 Score: 52.0 bits (123), Expect = 6.640e-6 Identity = 25/71 (35.21%), Postives = 43/71 (60.56%), Query Frame = 1 Query: 4 LARLVSSSCDRLEDSTIAI-RYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFREDREAS 213 + ++++ + D++E +T I +YL NV+ HP E KYRKI+K+NR F+ +V G A GF+ + + Sbjct: 148 MIKMLNKNPDKIEAATATINKYLSNVMAHPDEEKYRKIRKNNRVFSEKVSSVEGCEEFLEACGFKRSLDGT 218
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: Uncharacterized (protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UFY3_SALR5) HSP 1 Score: 52.0 bits (123), Expect = 6.790e-6 Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 1 Query: 61 RYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFREDRE 207 + L N+V+HP +PKYR+++K+N +++ PG A LAIGFRE E Sbjct: 241 KLLGNLVDHPDDPKYRRVRKENAALQRDLFGHPGGVEAVLAIGFRESEE 289
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: Putative (ubiquitin regulatory protein n=2 Tax=Phlebotominae TaxID=7198 RepID=A0A7G3B0L4_LUTLO) HSP 1 Score: 51.6 bits (122), Expect = 9.110e-6 Identity = 26/68 (38.24%), Postives = 37/68 (54.41%), Query Frame = 1 Query: 7 ARLVSSSCDRLEDSTIAI----RYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRE 198 A L+ +C+ E + + +YLEN++NHP E KYRKI+ NR F+ +V G A GF E Sbjct: 158 ACLIIQNCNTKEKADACVETLTKYLENIINHPDEEKYRKIRMSNRIFSEKVRNVEGSMEFLFAAGFEE 225
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: CSON009594 (protein n=1 Tax=Culicoides sonorensis TaxID=179676 RepID=A0A336M5Y8_CULSO) HSP 1 Score: 51.6 bits (122), Expect = 9.130e-6 Identity = 24/47 (51.06%), Postives = 29/47 (61.70%), Query Frame = 1 Query: 58 IRYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRE 198 IRY+EN++NHP E KYRKI+ NR F +V G AIGF E Sbjct: 197 IRYIENIINHPDEEKYRKIRMSNRIFQEKVEHVEGALDFLRAIGFTE 243
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: UBX (domain-containing protein 6-like n=2 Tax=Ciona intestinalis TaxID=7719 RepID=H2XTR2_CIOIN) HSP 1 Score: 51.2 bits (121), Expect = 1.240e-5 Identity = 23/66 (34.85%), Postives = 43/66 (65.15%), Query Frame = 1 Query: 4 LARLVSSSCDRLEDST-IAIRYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRE 198 + + +++S D+++ + I IRY++N++ HPGE KY+KI+K+N+ F +V G A GF++ Sbjct: 159 MMKTLNTSQDKVQAAVDIIIRYIDNIIAHPGEEKYQKIRKNNKVFTEKVASVEGAEEFLEAAGFQK 224
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: Hypothetical (protein n=1 Tax=Hanusia phi TaxID=3032 RepID=A0A7S0HJY3_9CRYP) HSP 1 Score: 51.2 bits (121), Expect = 1.280e-5 Identity = 25/68 (36.76%), Postives = 37/68 (54.41%), Query Frame = 1 Query: 4 LARLVSSSCDRLEDSTIAIRYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFREDRE 207 L R S + + + + ++ N VNHP EPKYRKI+K N F + + + G A +A GF+E E Sbjct: 414 LKRSCGSDSEFISATKTLLTFISNCVNHPTEPKYRKIRKGNTTFQARLGNKQGGVEALVAFGFKEVSE 481
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Match: UBX (domain-containing protein 6 n=1 Tax=Contarinia nasturtii TaxID=265458 RepID=UPI0012D431CE) HSP 1 Score: 50.4 bits (119), Expect = 2.340e-5 Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 1 Query: 13 LVSSSCDRLEDSTIAI----RYLENVVNHPGEPKYRKIKKDNRRFASEVWLQPGIRTAFLAIGFRE 198 L+ +C+ E ST I +YL+N++ HP + KYRKI++ NR F +V G LA GF E Sbjct: 167 LIILNCNTKEKSTACIETLSKYLQNIIQHPDDEKYRKIRQSNRIFCEKVQPCEGALDFLLAAGFIE 232 The following BLAST results are available for this feature:
BLAST of mRNA_E_fasciculatus_S2_contig983.17840.1 vs.
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus fasciculatus EfasUO2 vs UniRef90) Total hits: 23 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E_fasciculatus_S2_contig983.17840.1 >prot_E_fasciculatus_S2_contig983.17840.1 ID=prot_E_fasciculatus_S2_contig983.17840.1|Name=mRNA_E_fasciculatus_S2_contig983.17840.1|organism=Ectocarpus fasciculatus EfasUO2|type=polypeptide|length=78bp SLARLVSSSCDRLEDSTIAIRYLENVVNHPGEPKYRKIKKDNRRFASEVWback to top mRNA from alignment at E_fasciculatus_S2_contig983:24438..25345- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E_fasciculatus_S2_contig983.17840.1 ID=mRNA_E_fasciculatus_S2_contig983.17840.1|Name=mRNA_E_fasciculatus_S2_contig983.17840.1|organism=Ectocarpus fasciculatus EfasUO2|type=mRNA|length=908bp|location=Sequence derived from alignment at E_fasciculatus_S2_contig983:24438..25345- (Ectocarpus fasciculatus EfasUO2)back to top Coding sequence (CDS) from alignment at E_fasciculatus_S2_contig983:24438..25345- >mRNA_E_fasciculatus_S2_contig983.17840.1 ID=mRNA_E_fasciculatus_S2_contig983.17840.1|Name=mRNA_E_fasciculatus_S2_contig983.17840.1|organism=Ectocarpus fasciculatus EfasUO2|type=CDS|length=234bp|location=Sequence derived from alignment at E_fasciculatus_S2_contig983:24438..25345- (Ectocarpus fasciculatus EfasUO2)back to top |