Homology
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9960.1.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR015943 | WD40/YVTN repeat-like-containing domain superfamily | GENE3D | 2.130.10.10 | | coord: 1..51 e-value: 2.5E-8 score: 35.3 |
IPR036322 | WD40-repeat-containing domain superfamily | SUPERFAMILY | 50978 | WD40 repeat-like | coord: 1..42 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig9960.1.1 ID=prot_D-mesarthrocarpus_Contig9960.1.1|Name=mRNA_D-mesarthrocarpus_Contig9960.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=51bp VVVWDVATKEISVVVHGFHTMGIGHVAWSPCGMMLASIGGDGGHTLAVHT V back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR015943 | WD40/YVTN_repeat-like_dom_sf |
IPR036322 | WD40_repeat_dom_sf |
|