prot_D-mesarthrocarpus_Contig9840.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A6H5KZU9_9PHAE (Protein O-GlcNAc transferase n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KZU9_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 8.340e-14 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLKA 37 QQCIRIDP FAEAYSNLGNALKELGD+ GAIQFYLKA Sbjct: 137 QQCIRIDPNFAEAYSNLGNALKELGDVGGAIQFYLKA 173
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A835ZDI7_9STRA (Protein O-GlcNAc transferase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZDI7_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 2.890e-13 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLK 36 QQCIR+DP FAEAYSNLGNALKELGDINGA+QFY+K Sbjct: 55 QQCIRVDPGFAEAYSNLGNALKELGDINGAVQFYVK 90
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A7S2WWR9_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WWR9_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 9.170e-13 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLKA 37 QQC+R+ P FAEAYSNLGNALKELGD GA+QFYLKA Sbjct: 65 QQCVRVQPNFAEAYSNLGNALKELGDCAGAVQFYLKA 101
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A1W0A6E6_9STRA (Protein O-GlcNAc transferase (Fragment) n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0A6E6_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 4.840e-12 Identity = 30/37 (81.08%), Postives = 35/37 (94.59%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLKA 37 QQCIRI+P FAEA+ NLGNALKE+GDINGA+QFYL+A Sbjct: 135 QQCIRIEPHFAEAFGNLGNALKEIGDINGAVQFYLRA 171
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A067CJ54_SAPPC (Protein O-GlcNAc transferase (Fragment) n=3 Tax=Saprolegnia TaxID=4769 RepID=A0A067CJ54_SAPPC) HSP 1 Score: 68.2 bits (165), Expect = 1.220e-11 Identity = 29/37 (78.38%), Postives = 35/37 (94.59%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLKA 37 QQCIRI+P FAEA+ NLGNALKE+GD+NGA+QFYL+A Sbjct: 94 QQCIRIEPHFAEAFGNLGNALKEIGDMNGAVQFYLRA 130
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A482RRV3_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RRV3_9ARCH) HSP 1 Score: 63.5 bits (153), Expect = 8.380e-11 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLK 36 QQCI++DP AEA+SNLGNALKELGD+ GA QFYLK Sbjct: 103 QQCIKVDPHCAEAFSNLGNALKELGDLKGATQFYLK 138
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A3R7HUL3_9STRA (Protein O-GlcNAc transferase n=4 Tax=Phytophthora TaxID=4783 RepID=A0A3R7HUL3_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 1.090e-10 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 0 Query: 3 CIRIDPTFAEAYSNLGNALKELGDINGAIQFYLKAVK 39 CIR+ P FAEAY NLGNALKELGD+ GA+QFY++A+K Sbjct: 32 CIRVAPNFAEAYGNLGNALKELGDLQGAVQFYVRAIK 68
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A7S3MGN8_9STRA (Protein O-GlcNAc transferase n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3MGN8_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 1.090e-10 Identity = 29/36 (80.56%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYLK 36 QQCIR+D FAEAYSNLGNALKELGD+ GA +FYLK Sbjct: 122 QQCIRVDANFAEAYSNLGNALKELGDLKGATKFYLK 157
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A7S1C5Z1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1C5Z1_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 1.090e-10 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFY 34 QQ IRIDP FAEAY NLGNALKELGDI+G++QFY Sbjct: 62 QQAIRIDPNFAEAYGNLGNALKELGDIDGSVQFY 95
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Match: A0A6G0XEP2_9STRA (Protein O-GlcNAc transferase n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XEP2_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 2.030e-10 Identity = 29/35 (82.86%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 1 QQCIRIDPTFAEAYSNLGNALKELGDINGAIQFYL 35 QQCIRIDP FAEA+ NLGNALKE+GD GAIQFYL Sbjct: 86 QQCIRIDPQFAEAFGNLGNALKEIGDSQGAIQFYL 120 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9840.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig9840.1.1 ID=prot_D-mesarthrocarpus_Contig9840.1.1|Name=mRNA_D-mesarthrocarpus_Contig9840.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=75bpback to top |