Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR036612 | K Homology domain, type 1 superfamily | GENE3D | 3.30.1370.10 | K Homology domain, type 1 | coord: 32..103 e-value: 1.6E-5 score: 26.5 |
IPR036612 | K Homology domain, type 1 superfamily | SUPERFAMILY | 54791 | Eukaryotic type KH-domain (KH-domain type I) | coord: 22..102 |
IPR004088 | K Homology domain, type 1 | PFAM | PF00013 | KH_1 | coord: 47..99 e-value: 1.9E-5 score: 24.4 |
None | No IPR available | PROSITE | PS50084 | KH_TYPE_1 | coord: 28..98 score: 8.91103 |
None | No IPR available | CDD | cd00105 | KH-I | coord: 47..97 e-value: 3.75139E-4 score: 35.6136 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig9827.2.1 ID=prot_D-mesarthrocarpus_Contig9827.2.1|Name=mRNA_D-mesarthrocarpus_Contig9827.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=205bp IGVGLGQVCPPPPLAGVPCPREFGAPPPTVESFAVSCKDASILLEGGGEI LASLEGRRGVKIDILPQGDPRAPPSAPEHRVIRVTGGQEQVRAALEAMRA LASVQPLEAWLEAQKQKLNHQEALNALHVAARELTAVTQASRPRQRWCLG SDWHSFSPQLIALAMRNKRNADLRRNALQVTRKIAEAGKPPSPPVLLLHA VRNA* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|