prot_D-mesarthrocarpus_Contig9753.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A0G4F3L1_VITBC (Uncharacterized protein n=4 Tax=Vitrella brassicaformis TaxID=1169539 RepID=A0A0G4F3L1_VITBC) HSP 1 Score: 77.4 bits (189), Expect = 1.960e-15 Identity = 34/46 (73.91%), Postives = 44/46 (95.65%), Query Frame = 0 Query: 1 KPSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQEV 46 +P+ IQR+AIPQ+LSGGN+VFAA TGSGKTLAYLLP++QHLK++E+ Sbjct: 867 EPTAIQRLAIPQVLSGGNIVFAAETGSGKTLAYLLPMMQHLKSEEL 912
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A7S2V6I9_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V6I9_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 4.770e-14 Identity = 34/45 (75.56%), Postives = 42/45 (93.33%), Query Frame = 0 Query: 1 KPSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQE 45 +PS IQ +AIPQ+++GGN+VFAAATGSGKTLAYLLP+IQ L+AQE Sbjct: 129 RPSKIQAMAIPQVMTGGNMVFAAATGSGKTLAYLLPVIQQLRAQE 173
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A6H5KY63_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY63_9PHAE) HSP 1 Score: 73.2 bits (178), Expect = 6.080e-14 Identity = 35/44 (79.55%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 2 PSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQE 45 PS IQR AIPQ+L+GGNVVFAA+TGSGKTLAYL+PLIQ LK +E Sbjct: 158 PSKIQRKAIPQILNGGNVVFAASTGSGKTLAYLMPLIQQLKVEE 201
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: D7FZQ1_ECTSI (DEAD box helicase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZQ1_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 8.250e-14 Identity = 34/44 (77.27%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 2 PSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQE 45 PS IQR AIPQ+L+GGN+VFAA+TGSGKTLAYL+PLIQ LK +E Sbjct: 41 PSKIQRKAIPQILNGGNIVFAASTGSGKTLAYLMPLIQQLKVEE 84
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A836CEI1_9STRA (DEAD box helicase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CEI1_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 2.110e-13 Identity = 35/44 (79.55%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 2 PSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQE 45 PS IQRIAIPQ+ SGGN+V AAATGSGKTLAYLLP+I LK+QE Sbjct: 42 PSSIQRIAIPQITSGGNMVVAAATGSGKTLAYLLPVINALKSQE 85
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A7S4LLS1_9EUGL (Hypothetical protein n=1 Tax=Eutreptiella gymnastica TaxID=73025 RepID=A0A7S4LLS1_9EUGL) HSP 1 Score: 62.8 bits (151), Expect = 2.790e-10 Identity = 29/45 (64.44%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 2 PSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQEV 46 PS IQ++ IP+L+ G ++ +AA TGSGKTLAYLLP+IQ LKAQE+ Sbjct: 86 PSPIQQMVIPRLMRGESLAYAATTGSGKTLAYLLPVIQELKAQEL 130
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A6F9DB93_9ASCI (RNA helicase n=1 Tax=Phallusia mammillata TaxID=59560 RepID=A0A6F9DB93_9ASCI) HSP 1 Score: 59.7 bits (143), Expect = 3.410e-9 Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 0 Query: 1 KPSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQEV 46 KP+ IQ I+IP LSG N+V A TGSGKTL+++LP IQH+KAQ V Sbjct: 192 KPTPIQSISIPVALSGTNLVGIAQTGSGKTLSFILPAIQHIKAQTV 237
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A5A7P5W8_STRAF (Dead box ATP-dependent RNA helicase n=1 Tax=Striga asiatica TaxID=4170 RepID=A0A5A7P5W8_STRAF) HSP 1 Score: 58.5 bits (140), Expect = 8.710e-9 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 1 KPSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKAQ 44 KP+ IQR+AIP +L G +VV A TGSGKTLAYLLPL+Q L A+ Sbjct: 69 KPTPIQRVAIPLILEGKDVVARAKTGSGKTLAYLLPLLQKLFAE 112
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A2C9UQT0_MANES (Uncharacterized protein n=7 Tax=Crotonoideae TaxID=235631 RepID=A0A2C9UQT0_MANES) HSP 1 Score: 58.2 bits (139), Expect = 1.190e-8 Identity = 29/43 (67.44%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 1 KPSGIQRIAIPQLLSGGNVVFAAATGSGKTLAYLLPLIQHLKA 43 KP+ IQR+AIP +L G +VV A TGSGKTLAYLLPL+Q L A Sbjct: 52 KPTPIQRVAIPLILEGKDVVARAKTGSGKTLAYLLPLVQKLFA 94
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Match: A0A433PX60_9FUNG (P-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Endogone sp. FLAS-F59071 TaxID=2340872 RepID=A0A433PX60_9FUNG) HSP 1 Score: 58.2 bits (139), Expect = 1.190e-8 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 2 PSGIQRIAIPQL--LSGGNVVFAAATGSGKTLAYLLPLIQHLKAQE 45 P+ IQ +AIP+L L +++ AA TGSGKTLAYLLP+IQHLKAQE Sbjct: 282 PTEIQALAIPELMRLKKPHILCAAETGSGKTLAYLLPIIQHLKAQE 327 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9753.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig9753.1.1 ID=prot_D-mesarthrocarpus_Contig9753.1.1|Name=mRNA_D-mesarthrocarpus_Contig9753.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=46bpback to top |