Homology
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10204.2.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR007123 | Gelsolin-like domain | PFAM | PF00626 | Gelsolin | coord: 60..100 e-value: 5.4E-7 score: 29.4 |
IPR029006 | ADF-H/Gelsolin-like domain superfamily | GENE3D | 3.40.20.10 | Severin | coord: 39..117 e-value: 4.0E-9 score: 38.3 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 28..42 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 24..48 |
None | No IPR available | SUPERFAMILY | 55753 | Actin depolymerizing proteins | coord: 61..107 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10204.2.1 ID=prot_D-mesarthrocarpus_Contig10204.2.1|Name=mRNA_D-mesarthrocarpus_Contig10204.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=120bp ICAKAGDGKSVRCVLSEGMGGSSERRNAGELQLDRGVGEAGGEEERPWWP PYVQELGPLGVFSQDDLIQDGCFLLDTGGDAVFAWHGKASSQEARDLCVR LGKVYVSSTLVGVEASPIIT back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR007123 | Gelsolin-like_dom |
IPR029006 | ADF-H/Gelsolin-like_dom_sf |
|