prot_D-mesarthrocarpus_Contig10166.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: D7G3D1_ECTSI (Rad21_Rec8_N domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G3D1_ECTSI) HSP 1 Score: 84.0 bits (206), Expect = 7.840e-18 Identity = 38/41 (92.68%), Postives = 39/41 (95.12%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIWIAAHWDKKLNK QIFQTN+NTSV Sbjct: 1 MFYSQIILAKKGPLGKIWIAAHWDKKLNKAQIFQTNINTSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A7R9Y943_9STRA (Hypothetical protein n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9Y943_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 7.480e-15 Identity = 33/41 (80.49%), Postives = 38/41 (92.68%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKL K QIFQT++++SV Sbjct: 1 MFYSQLILAKKGPLGKIWLAAHWDKKLTKAQIFQTDISSSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A2P4XFU8_9STRA (Double-strand-break repair protein rad21 n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4XFU8_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 1.380e-14 Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF +++TSV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHTSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A2P4YM93_9STRA (Double-strand-break repair protein rad21 n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4YM93_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 1.390e-14 Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF +++TSV Sbjct: 185 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHTSV 225
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A7S2S5L9_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2S5L9_9STRA) HSP 1 Score: 74.3 bits (181), Expect = 1.910e-14 Identity = 33/41 (80.49%), Postives = 36/41 (87.80%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKL K QIFQT++ SV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLTKVQIFQTDIERSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A662XSX1_9STRA (Uncharacterized protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XSX1_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 4.860e-14 Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF ++++SV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHSSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A225X301_9STRA (Double-strand-break repair protein rad21 n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225X301_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 4.860e-14 Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF ++++SV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHSSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: H3GTZ6_PHYRM (Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GTZ6_PHYRM) HSP 1 Score: 73.2 bits (178), Expect = 4.860e-14 Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF ++++SV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHSSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A6A3TN23_9STRA (Uncharacterized protein n=4 Tax=Phytophthora TaxID=4783 RepID=A0A6A3TN23_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 4.860e-14 Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF ++++SV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHSSV 41
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Match: A0A0P1B0L1_PLAHL (Double-strand-break repair protein rad21 n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1B0L1_PLAHL) HSP 1 Score: 73.2 bits (178), Expect = 4.860e-14 Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 1 MFYSQTILAKKGPLGKIWIAAHWDKKLNKTQIFQTNVNTSV 41 MFYSQ ILAKKGPLGKIW+AAHWDKKLNK QIF ++++SV Sbjct: 1 MFYSQIILAKKGPLGKIWLAAHWDKKLNKQQIFTADIHSSV 41 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10166.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10166.1.1 ID=prot_D-mesarthrocarpus_Contig10166.1.1|Name=mRNA_D-mesarthrocarpus_Contig10166.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=41bpback to top |