prot_D-mesarthrocarpus_Contig1014.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI001FB626C3 (deleted in lung and esophageal cancer protein 1 isoform X1 n=3 Tax=Mugil cephalus TaxID=48193 RepID=UPI001FB626C3) HSP 1 Score: 51.6 bits (122), Expect = 1.940e-6 Identity = 22/41 (53.66%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF V+P+AGTL P+ ++ V +TAY D G+Y+DR+ C Sbjct: 1154 GKGAAFFVLPDAGTLGPFETQTVDVTAYTDMWGEYRDRLIC 1194
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI00094F3642 (deleted in lung and esophageal cancer protein 1 isoform X1 n=3 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094F3642) HSP 1 Score: 50.8 bits (120), Expect = 3.630e-6 Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF +VP AGTL P+ ++ V +TAY+D GDY+D + C Sbjct: 1138 GKGAAFFIVPCAGTLEPFETQTVDVTAYSDMWGDYRDNLVC 1178
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI000497D68B (deleted in lung and esophageal cancer protein 1 n=1 Tax=Stegastes partitus TaxID=144197 RepID=UPI000497D68B) HSP 1 Score: 50.4 bits (119), Expect = 4.970e-6 Identity = 21/41 (51.22%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF+V+P+AGTL P+ ++ V +TAY D G+Y+D + C Sbjct: 1111 GKGAAFIVLPDAGTLGPFETQTVDVTAYTDMWGEYRDHLIC 1151
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI001CD82A8C (deleted in lung and esophageal cancer protein 1 isoform X1 n=2 Tax=Solea senegalensis TaxID=28829 RepID=UPI001CD82A8C) HSP 1 Score: 50.1 bits (118), Expect = 6.800e-6 Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAFLV+P GTL P+ ++ V +TAY D G+Y+DR+ C Sbjct: 1117 GKGAAFLVLPNTGTLGPFETQIVDVTAYTDMWGEYRDRLIC 1157
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI00188627C9 (deleted in lung and esophageal cancer protein 1 isoform X1 n=4 Tax=Syngnathus acus TaxID=161584 RepID=UPI00188627C9) HSP 1 Score: 50.1 bits (118), Expect = 6.800e-6 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 3 GAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 GAAF +VP AGTL P+ ++ V +TAY+D G+YKD + C Sbjct: 1102 GAAFFIVPSAGTLEPFETQTVDVTAYSDVWGEYKDNLIC 1140
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI00189D8479 (deleted in lung and esophageal cancer protein 1 n=1 Tax=Sebastes umbrosus TaxID=72105 RepID=UPI00189D8479) HSP 1 Score: 49.7 bits (117), Expect = 9.300e-6 Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF V+P+AGTL P+ ++ V +TAY D G+Y+D + C Sbjct: 1120 GKGAAFFVLPDAGTLGPFETQTVDVTAYTDMWGEYRDHLIC 1160
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI001C35A271 ((large yellow croaker) hypothetical protein n=1 Tax=Larimichthys crocea TaxID=215358 RepID=UPI001C35A271) HSP 1 Score: 49.7 bits (117), Expect = 9.320e-6 Identity = 21/41 (51.22%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF VVP+ GTL P+ ++ V +TAY D G+Y+D + C Sbjct: 392 GKGAAFFVVPDTGTLGPFETQTVDVTAYTDMWGEYRDHLVC 432
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: UPI0010549D29 (deleted in lung and esophageal cancer protein 1 isoform X1 n=2 Tax=Gouania willdenowi TaxID=441366 RepID=UPI0010549D29) HSP 1 Score: 48.9 bits (115), Expect = 1.740e-5 Identity = 22/41 (53.66%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAFLV P GTL P+ ++ V +TAYND G+Y+D + C Sbjct: 1141 GKGAAFLVQPPTGTLGPFQTQIVDVTAYNDLWGEYRDHLIC 1181
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: A0A4W6DBC8_LATCA (DLEC1 cilia and flagella associated protein n=3 Tax=Lates calcarifer TaxID=8187 RepID=A0A4W6DBC8_LATCA) HSP 1 Score: 48.9 bits (115), Expect = 1.740e-5 Identity = 21/41 (51.22%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF V+P GTL P+ ++ V +TAY D G+Y+DR+ C Sbjct: 885 GKGAAFYVLPNTGTLGPFETQTVDVTAYTDMWGEYRDRLIC 925
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Match: A0A3Q3IVW4_MONAL (DLEC1 cilia and flagella associated protein n=2 Tax=Monopterus albus TaxID=43700 RepID=A0A3Q3IVW4_MONAL) HSP 1 Score: 48.5 bits (114), Expect = 2.380e-5 Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 0 Query: 1 GHGAAFLVVPEAGTLPPWGSKEVKITAYNDTPGDYKDRVEC 41 G GAAF V+P GTL P+ ++ V +TAY D G+YKD + C Sbjct: 1128 GKGAAFFVLPNTGTLGPFETQTVDVTAYTDIWGEYKDHLIC 1168 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig1014.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 20 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig1014.1.1 ID=prot_D-mesarthrocarpus_Contig1014.1.1|Name=mRNA_D-mesarthrocarpus_Contig1014.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=41bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|