prot_D-mesarthrocarpus_Contig10111.2.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: UPI001ACCF7DF (Ribosomal RNA large subunit methyltransferase L n=1 Tax=Myxococcaceae bacterium TaxID=2484252 RepID=UPI001ACCF7DF) HSP 1 Score: 62.0 bits (149), Expect = 4.100e-10 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 2 KTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 +TP DPFCGSGT IEAA+LARGRAPGR+ FA EAW Sbjct: 202 QTPLVDPFCGSGTLVIEAALLARGRAPGRDRSFAFEAW 239
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: A0A2E3RBZ7_9PLAN (Bifunctional 23S rRNA (Guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (Guanine(2445)-N(2))-methyltransferase RlmL n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E3RBZ7_9PLAN) HSP 1 Score: 58.2 bits (139), Expect = 9.490e-9 Identity = 25/36 (69.44%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 4 PFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 PF DPFCGSGT IEAAM+ R APGRN +FA E+W Sbjct: 195 PFVDPFCGSGTIPIEAAMIGRNLAPGRNRKFAAESW 230
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: A0A7Z9LYL7_9PLAN (Bifunctional 23S rRNA (Guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (Guanine(2445)-N(2))-methyltransferase RlmL n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A7Z9LYL7_9PLAN) HSP 1 Score: 58.2 bits (139), Expect = 9.500e-9 Identity = 27/38 (71.05%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 2 KTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 K PF DPFCGSGT IEAAMLAR APGRN FA W Sbjct: 192 KRPFMDPFCGSGTIPIEAAMLARNMAPGRNREFAASDW 229
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: UPI00195CA242 (class I SAM-dependent RNA methyltransferase n=1 Tax=Oscillibacter sp. CU971 TaxID=2780102 RepID=UPI00195CA242) HSP 1 Score: 57.4 bits (137), Expect = 1.760e-8 Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 2 KTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 K PF DPFCGSGT IEAA++AR RAPG + RFA + W Sbjct: 189 KDPFCDPFCGSGTIPIEAALIARNRAPGLDRRFAAQKW 226
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: A0A3L7PIR2_9BACT (Class I SAM-dependent RNA methyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A3L7PIR2_9BACT) HSP 1 Score: 57.4 bits (137), Expect = 1.780e-8 Identity = 26/36 (72.22%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 4 PFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 PFADPFCGSGT IEAAM+AR RAPG N F E W Sbjct: 193 PFADPFCGSGTIPIEAAMIARNRAPGANRAFQCEQW 228
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: A0A6I3F2B6_9ACTN (Class I SAM-dependent RNA methyltransferase n=2 Tax=root TaxID=1 RepID=A0A6I3F2B6_9ACTN) HSP 1 Score: 57.0 bits (136), Expect = 2.400e-8 Identity = 25/38 (65.79%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 2 KTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 KTP DPFCGSGT IEAA++AR APGRN FA + W Sbjct: 180 KTPLVDPFCGSGTIAIEAALIARRMAPGRNRSFAFQQW 217
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: W0R913_9BACT (RNA methylase n=1 Tax=Gemmatirosa kalamazoonesis TaxID=861299 RepID=W0R913_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 2.420e-8 Identity = 27/39 (69.23%), Postives = 28/39 (71.79%), Query Frame = 0 Query: 1 PKTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 P TP DP CGSGT IEAA+LAR APGR RFA EAW Sbjct: 203 PTTPLVDPMCGSGTIPIEAALLARRIAPGRQRRFAFEAW 241
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: UPI001BB47BD3 (class I SAM-dependent RNA methyltransferase n=1 Tax=Dysosmobacter sp. Marseille-Q4140 TaxID=2830675 RepID=UPI001BB47BD3) HSP 1 Score: 56.2 bits (134), Expect = 4.510e-8 Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 2 KTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 K PF DPFCGSGT IEAA++A+ RAPG + RFA + W Sbjct: 188 KDPFCDPFCGSGTIPIEAALIAKNRAPGLDRRFAAQKW 225
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: A0A1Q6Q735_9FIRM (RNA methyltransferase n=7 Tax=Firmicutes TaxID=1239 RepID=A0A1Q6Q735_9FIRM) HSP 1 Score: 56.2 bits (134), Expect = 4.510e-8 Identity = 24/38 (63.16%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 2 KTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 + PF DPFCGSGT IEAA++AR RAPG N FA + W Sbjct: 189 RDPFCDPFCGSGTIAIEAALIARNRAPGLNRSFAAQHW 226
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Match: A0A0R2CVX6_9LACO (rRNA (Guanine-N(2)-)-methyltransferase n=1 Tax=Lentilactobacillus senioris DSM 24302 = JCM 17472 TaxID=1423802 RepID=A0A0R2CVX6_9LACO) HSP 1 Score: 56.2 bits (134), Expect = 4.530e-8 Identity = 26/39 (66.67%), Postives = 28/39 (71.79%), Query Frame = 0 Query: 1 PKTPFADPFCGSGTRGIEAAMLARGRAPGRNPRFAVEAW 39 P PF DPFCGSGT IEAA++AR APG N FA EAW Sbjct: 189 PDMPFLDPFCGSGTIAIEAALIARNIAPGFNRDFAFEAW 227 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10111.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10111.2.1 ID=prot_D-mesarthrocarpus_Contig10111.2.1|Name=mRNA_D-mesarthrocarpus_Contig10111.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=41bpback to top |