Homology
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig1008.6.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 64..123 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 69..88 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 96..123 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig1008.6.1 ID=prot_D-mesarthrocarpus_Contig1008.6.1|Name=mRNA_D-mesarthrocarpus_Contig1008.6.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=136bp LRGWALHRPSHVLEGGREHPIQTPVKVWGEKPRPGGWFPTSLLVFVLYWP FGLDDMELFSDRMSEGRSKGETSSVSPNEVNDLIRDAISNPSSMEKLGGR RKRPTGRAELRETGLDPFRRTSEKDSDSIGNLLCLR back to top
|