Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10030.1.1 vs. uniprot
Match:
A0A7S2UUC5_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UUC5_9STRA)
HSP 1 Score: 53.1 bits (126), Expect = 4.570e-5
Identity = 46/153 (30.07%), Postives = 69/153 (45.10%), Query Frame = 0
Query: 20 VKLPKPKLGMATLRKEYLVDP-DGRRSSCELLESAESGKTFFLIRPFGDGAIYGEVWHALEVCVDYNAGEYTPRLDVDGKKREFAVKRMDWDKINNPREKKCENPLHEIAALEILS------------------EPGHPNVLKLVEALNDGGL 153
+ P+P + A L ++ + D G + L S SG + L+R + IYG+V HA+ + VD G Y + A+K M KI R + E+P+ EIAA++ LS + GHPNVL L+E + D L
Sbjct: 8 LSFPRPVISAAFLDRKVVRDQRSGNLVEGQCLVSVASGNVYLLVRTLRE-CIYGKVKHAIRI-VDVGNGVYEYGREY------VAIKVMFKRKIQELRGRHNEDPIKEIAAMQFLSTAPEGVEGTKQGEGESTHQGGHPNVLPLLECVQDEDL 152
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10030.1.1 vs. uniprot
Analysis Date: 2022-09-16 (
Diamond blastp: OGS1.0 vs UniRef90 )
Total hits: 1
M E D N G R G M Q R D A R T P P R K S V K L P K P K L G M A T L R K E Y L V D P D G R R S S C E L L E S A E S G K T F F L I R P F G D G A I Y G E V W H A L E V C V D Y N A G E Y T P R L D V D G K K R E F A V K R M D W D K I N N P R E K K C E N P L H E I A A L E I L S E P G H P N V L K L V E A L N D G G L P L V C G W G L S C V Q A H L L C C M I A L K E * 20 40 60 80 100 120 140 160 Expect = 4.57e-5 / Id = 30.07 Sequence A0A7S2UUC5_9STRA
Match Name E-value Identity Description
A0A7S2UUC5_9STRA 4.570e-5 30.07 Hypothetical protein n=1 Tax=Fibrocapsa japonica T... [more]
back to top
InterPro
Analysis Name:
InterProScan on OGS1.0
Date Performed: 2022-09-29
M E D N G R G M Q R D A R T P P R K S V K L P K P K L G M A T L R K E Y L V D P D G R R S S C E L L E S A E S G K T F F L I R P F G D G A I Y G E V W H A L E V C V D Y N A G E Y T P R L D V D G K K R E F A V K R M D W D K I N N P R E K K C E N P L H E I A A L E I L S E P G H P N V L K L V E A L N D G G L P L V C G W G L S C V Q A H L L C C M I A L K E * 20 40 60 80 100 120 140 160 Score = Score = Score = Sequence mobidb-lite mobidb-lite SSF56112
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..23
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..18
IPR011009 Protein kinase-like domain superfamily SUPERFAMILY 56112 Protein kinase-like (PK-like) coord: 58..152
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>prot_D-mesarthrocarpus_Contig10030.1.1 ID=prot_D-mesarthrocarpus_Contig10030.1.1|Name=mRNA_D-mesarthrocarpus_Contig10030.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=178bp MEDNGRGMQRDARTPPRKSVKLPKPKLGMATLRKEYLVDPDGRRSSCELL ESAESGKTFFLIRPFGDGAIYGEVWHALEVCVDYNAGEYTPRLDVDGKKR EFAVKRMDWDKINNPREKKCENPLHEIAALEILSEPGHPNVLKLVEALND GGLPLVCGWGLSCVQAHLLCCMIALKE* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR011009 Kinase-like_dom_sf