Homology
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10005.3.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR005331 | Sulfotransferase | PFAM | PF03567 | Sulfotransfer_2 | coord: 43..109 e-value: 3.1E-6 score: 27.5 |
IPR027417 | P-loop containing nucleoside triphosphate hydrolase | GENE3D | 3.40.50.300 | | coord: 11..114 e-value: 7.5E-12 score: 47.1 |
IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 10..111 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10005.3.1 ID=prot_D-mesarthrocarpus_Contig10005.3.1|Name=mRNA_D-mesarthrocarpus_Contig10005.3.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=115bp HYAPGVIKGLPNIMFIKPHKVGSSSMSIVLRLIAARNNGVRREYMYTLSK PDYFYALEELQPLEKGLHLWGDHQTLSTLLQYGKPEIIEDSFKITLVRDP LDRCLSSFYYYVLGG back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|