mRNA_D-mesarthrocarpus_Contig9992.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9992.1.1 vs. uniprot
Match: D7FVE5_ECTSI (Glutamine-dependent NAD(+) synthetase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVE5_ECTSI) HSP 1 Score: 73.6 bits (179), Expect = 8.210e-14 Identity = 38/59 (64.41%), Postives = 48/59 (81.36%), Query Frame = 1 Query: 1 QVVTATINLEDVRAFRASRSSLMEQASDAKSLPKVVAPCGFSLTTPGADYLSMPPTLPR 177 +V+TAT+NLEDVR++RAS SS MEQAS A+ LP V AP F L TPGA+Y++ PPTLP+ Sbjct: 274 EVITATVNLEDVRSYRASVSSRMEQASGARRLPTVEAP-SFCLGTPGANYVTHPPTLPQ 331
BLAST of mRNA_D-mesarthrocarpus_Contig9992.1.1 vs. uniprot
Match: A0A6H5JI49_9PHAE (NAD(+) synthase (glutamine-hydrolyzing) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JI49_9PHAE) HSP 1 Score: 73.6 bits (179), Expect = 8.220e-14 Identity = 38/59 (64.41%), Postives = 48/59 (81.36%), Query Frame = 1 Query: 1 QVVTATINLEDVRAFRASRSSLMEQASDAKSLPKVVAPCGFSLTTPGADYLSMPPTLPR 177 +V+TAT+NLEDVR++RAS SS MEQAS A+ LP V AP F L TPGA+Y++ PPTLP+ Sbjct: 348 EVITATVNLEDVRSYRASVSSRMEQASGARRLPTVEAP-SFCLGTPGANYVTHPPTLPQ 405 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9992.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig9992.1.1 >prot_D-mesarthrocarpus_Contig9992.1.1 ID=prot_D-mesarthrocarpus_Contig9992.1.1|Name=mRNA_D-mesarthrocarpus_Contig9992.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=60bp QVVTATINLEDVRAFRASRSSLMEQASDAKSLPKVVAPCGFSLTTPGADYback to top mRNA from alignment at D-mesarthrocarpus_Contig9992:74..253- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig9992.1.1 ID=mRNA_D-mesarthrocarpus_Contig9992.1.1|Name=mRNA_D-mesarthrocarpus_Contig9992.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=180bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9992:74..253- (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig9992:74..253- >mRNA_D-mesarthrocarpus_Contig9992.1.1 ID=mRNA_D-mesarthrocarpus_Contig9992.1.1|Name=mRNA_D-mesarthrocarpus_Contig9992.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=180bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9992:74..253- (Discosporangium mesarthrocarpum MT17_79)back to top |