mRNA_D-mesarthrocarpus_Contig9782.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: D7FUY8_ECTSI (Similar to Cullin-1 (CUL-1) isoform 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUY8_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 8.740e-13 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 1 SGFEYTSKLQRMFVDKALSRDLHTGYVEWQVR 96 SGFEYTSKLQRMFVDK LSRDLHTGYVEWQVR Sbjct: 508 SGFEYTSKLQRMFVDKTLSRDLHTGYVEWQVR 539
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A6H5JUU8_9PHAE (CULLIN_2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUU8_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 1.070e-11 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 1 Query: 1 SGFEYTSKLQRMFVDKALSRDLHTGYVEWQVREM 102 SGFEYTSKLQRMFVDK LSRDLHTGYVEWQ + + Sbjct: 122 SGFEYTSKLQRMFVDKTLSRDLHTGYVEWQEKRI 155
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A835YSZ1_9STRA (Cullin n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YSZ1_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 8.430e-10 Identity = 26/29 (89.66%), Postives = 28/29 (96.55%), Query Frame = 1 Query: 1 SGFEYTSKLQRMFVDKALSRDLHTGYVEW 87 SGFE+TSKLQRMFVDK LSRDLHTGY+EW Sbjct: 527 SGFEFTSKLQRMFVDKTLSRDLHTGYMEW 555
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A022W404_TRIRU (CULLIN_2 domain-containing protein n=3 Tax=Trichophyton TaxID=5550 RepID=A0A022W404_TRIRU) HSP 1 Score: 48.9 bits (115), Expect = 1.380e-5 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVR 96 GFEYT+KLQRMF D +S+DL+T Y EWQ R Sbjct: 468 GFEYTNKLQRMFQDIQISKDLNTNYREWQER 498
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: D4AZ42_ARTBC (CULLIN_2 domain-containing protein n=17 Tax=Arthrodermataceae TaxID=34384 RepID=D4AZ42_ARTBC) HSP 1 Score: 48.9 bits (115), Expect = 1.380e-5 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVR 96 GFEYT+KLQRMF D +S+DL+T Y EWQ R Sbjct: 450 GFEYTNKLQRMFQDIQISKDLNTNYREWQER 480
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: M2R5E6_COCSN (CULLIN_2 domain-containing protein n=38 Tax=Pleosporales TaxID=92860 RepID=M2R5E6_COCSN) HSP 1 Score: 48.1 bits (113), Expect = 2.580e-5 Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVREM 102 GFEYT+KLQRMF D +S+DL+T + EWQ + Sbjct: 486 GFEYTNKLQRMFQDMQISKDLNTAFKEWQANNL 518
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A3N4M1I5_9PEZI (Cullin-domain-containing protein n=1 Tax=Terfezia boudieri ATCC MYA-4762 TaxID=1051890 RepID=A0A3N4M1I5_9PEZI) HSP 1 Score: 47.4 bits (111), Expect = 4.830e-5 Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVRE 99 GFEYT+KLQRMF D +S+DL+ Y EW +E Sbjct: 494 GFEYTNKLQRMFQDMQISKDLNDSYKEWSAKE 525
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A8E2EI01_9PEZI (Cullin-domain-containing protein n=2 Tax=Pleosporomycetidae TaxID=451868 RepID=A0A8E2EI01_9PEZI) HSP 1 Score: 47.4 bits (111), Expect = 4.840e-5 Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVREM 102 GFEYT+KLQRMF D +S+DL++ Y EWQ + Sbjct: 490 GFEYTNKLQRMFQDMQISKDLNSSYKEWQQENL 522
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A6A6WIR0_9PEZI (Cullin-domain-containing protein n=1 Tax=Pseudovirgaria hyperparasitica TaxID=470096 RepID=A0A6A6WIR0_9PEZI) HSP 1 Score: 47.4 bits (111), Expect = 4.840e-5 Identity = 18/31 (58.06%), Postives = 26/31 (83.87%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVR 96 GFEYT+KLQRMF D +S+DL++ Y +WQ++ Sbjct: 490 GFEYTNKLQRMFQDMQISKDLNSSYKDWQMK 520
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Match: A0A1W5D7P5_9LECA (Cullin n=2 Tax=Lasallia pustulata TaxID=136370 RepID=A0A1W5D7P5_9LECA) HSP 1 Score: 47.4 bits (111), Expect = 4.840e-5 Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 1 Query: 4 GFEYTSKLQRMFVDKALSRDLHTGYVEWQVREM 102 GFEYT+KLQRMF D +S+DL+ Y EWQ + + Sbjct: 487 GFEYTNKLQRMFQDIQISKDLNRNYKEWQAKNL 519 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9782.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 13 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig9782.1.1 >prot_D-mesarthrocarpus_Contig9782.1.1 ID=prot_D-mesarthrocarpus_Contig9782.1.1|Name=mRNA_D-mesarthrocarpus_Contig9782.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=36bp SGFEYTSKLQRMFVDKALSRDLHTGYVEWQVREMT*back to top mRNA from alignment at D-mesarthrocarpus_Contig9782:253..360+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig9782.1.1 ID=mRNA_D-mesarthrocarpus_Contig9782.1.1|Name=mRNA_D-mesarthrocarpus_Contig9782.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=108bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9782:253..360+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig9782:253..360+ >mRNA_D-mesarthrocarpus_Contig9782.1.1 ID=mRNA_D-mesarthrocarpus_Contig9782.1.1|Name=mRNA_D-mesarthrocarpus_Contig9782.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=108bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9782:253..360+ (Discosporangium mesarthrocarpum MT17_79)back to top |