mRNA_D-mesarthrocarpus_Contig9774.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: F0W219_9STRA (Uncharacterized protein AlNc14C8G1093 n=4 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0W219_9STRA) HSP 1 Score: 79.7 bits (195), Expect = 7.550e-16 Identity = 33/63 (52.38%), Postives = 48/63 (76.19%), Query Frame = 1 Query: 1 DVALFLPTA--TRPQDRSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ T R +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q+A Sbjct: 851 DLALFLPTSGPTTESQRRVYLAFHLGCPHRFLSEESISSFSTSGSRYPDYVIGRIVLIDEQIA 913
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: W7TIE4_9STRA (Peripheral membrane protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TIE4_9STRA) HSP 1 Score: 79.3 bits (194), Expect = 1.030e-15 Identity = 37/65 (56.92%), Postives = 52/65 (80.00%), Query Frame = 1 Query: 1 DVALFLPTATRPQDRSIYLAFHINCPHRYLSSESIDTFK---EKDGKYPDFILGKIILIEQQVAE 186 DVALFLPT+ + ++R +YLAFH NCPHRYLS ES+++ + E G++PDFILGKI+ +E+ VA+ Sbjct: 916 DVALFLPTSHQGENR-VYLAFHTNCPHRYLSHESLESLRGGREGGGRFPDFILGKIVYVEEMVAK 979
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: A0A329S4M2_9STRA (ATG11 domain-containing protein n=1 Tax=Phytophthora cactorum TaxID=29920 RepID=A0A329S4M2_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 2.830e-15 Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q A Sbjct: 132 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVLIDEQTA 193
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: K3WGA8_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WGA8_GLOUD) HSP 1 Score: 77.0 bits (188), Expect = 6.690e-15 Identity = 34/63 (53.97%), Postives = 52/63 (82.54%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVAE 186 D+ALFLPT+ D + +YLAFH+ CPHR+LS+ESI +F +G+YPD+++G+I+LI++QVA+ Sbjct: 844 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSAESISSFSI-NGRYPDYVVGRIVLIDEQVAD 905
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: V9FBB8_PHYPR (Uncharacterized protein (Fragment) n=1 Tax=Phytophthora parasitica P1569 TaxID=1317065 RepID=V9FBB8_PHYPR) HSP 1 Score: 75.9 bits (185), Expect = 1.700e-14 Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q A Sbjct: 712 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVLIDEQTA 773
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: A0A3R7K0T3_9STRA (Uncharacterized protein n=3 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7K0T3_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 1.700e-14 Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q A Sbjct: 734 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVLIDEQTA 795
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: A0A6A3EVJ5_9STRA (ATG11 domain-containing protein n=6 Tax=Phytophthora TaxID=4783 RepID=A0A6A3EVJ5_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 1.700e-14 Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q A Sbjct: 772 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVLIDEQTA 833
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: A0A662XPG0_9STRA (ATG11 domain-containing protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XPG0_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 1.700e-14 Identity = 32/63 (50.79%), Postives = 47/63 (74.60%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVAE 186 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I++I+ Q AE Sbjct: 779 DLALFLPTSAPGSDSQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVMIDPQTAE 841
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: D0MQJ2_PHYIT (Uncharacterized protein n=42 Tax=Phytophthora TaxID=4783 RepID=D0MQJ2_PHYIT) HSP 1 Score: 75.9 bits (185), Expect = 1.710e-14 Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q A Sbjct: 800 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVLIDEQTA 861
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Match: A0A225X355_9STRA (Uncharacterized protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225X355_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 1.710e-14 Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 1 Query: 1 DVALFLPTATRPQD-RSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILGKIILIEQQVA 183 D+ALFLPT+ D + +YLAFH+ CPHR+LS ESI +F +YPD+++G+I+LI++Q A Sbjct: 832 DLALFLPTSAPGSDAQRVYLAFHLGCPHRFLSEESISSFSNDGQRYPDYVVGRIVLIDEQTA 893 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9774.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig9774.1.1 >prot_D-mesarthrocarpus_Contig9774.1.1 ID=prot_D-mesarthrocarpus_Contig9774.1.1|Name=mRNA_D-mesarthrocarpus_Contig9774.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=67bp DVALFLPTATRPQDRSIYLAFHINCPHRYLSSESIDTFKEKDGKYPDFILback to top mRNA from alignment at D-mesarthrocarpus_Contig9774:3700..4537+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig9774.1.1 ID=mRNA_D-mesarthrocarpus_Contig9774.1.1|Name=mRNA_D-mesarthrocarpus_Contig9774.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=838bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9774:3700..4537+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig9774:3700..4537+ >mRNA_D-mesarthrocarpus_Contig9774.1.1 ID=mRNA_D-mesarthrocarpus_Contig9774.1.1|Name=mRNA_D-mesarthrocarpus_Contig9774.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=201bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9774:3700..4537+ (Discosporangium mesarthrocarpum MT17_79)back to top |