mRNA_D-mesarthrocarpus_Contig9747.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A523DU62_9BACT (Integrase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A523DU62_9BACT) HSP 1 Score: 58.2 bits (139), Expect = 1.270e-9 Identity = 23/38 (60.53%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 4 RDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 +D P SR ++ RPS +A+V+ + +VGGLHHRYEWREAA Sbjct: 95 KDPPNSRPVRPRPSPEAKVVALPRVGGLHHRYEWREAA 132
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A2D6MLQ8_9DELT (Integrase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D6MLQ8_9DELT) HSP 1 Score: 58.2 bits (139), Expect = 8.800e-9 Identity = 25/39 (64.10%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 LRDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 LRDSP R + RPS A+V G+S+VGGLHHRY W+EAA Sbjct: 309 LRDSPMGRPTEPRPSLNAQVAGLSRVGGLHHRYGWQEAA 347
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A7C7ZJU5_9DELT (Integrase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A7C7ZJU5_9DELT) HSP 1 Score: 58.2 bits (139), Expect = 8.950e-9 Identity = 23/39 (58.97%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 LRDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 LRDSP R + RPS A+++G+ +VGGLHHRY WR+AA Sbjct: 328 LRDSPAGRPTEDRPSRNAQIVGLPRVGGLHHRYVWRDAA 366
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A523EEN3_9BACT (Integrase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A523EEN3_9BACT) HSP 1 Score: 52.8 bits (125), Expect = 8.530e-8 Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 1 Query: 4 RDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 +D+P R RPSS A V+ + +VGG HHRYEWREAA Sbjct: 64 KDTPNERDATPRPSSTARVVALPRVGGPHHRYEWREAA 101
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A0S7Z8S1_9BACT (Integrase catalytic domain-containing protein n=1 Tax=Gemmatimonas sp. SG8_23 TaxID=1703356 RepID=A0A0S7Z8S1_9BACT) HSP 1 Score: 53.5 bits (127), Expect = 1.720e-7 Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 1 LRDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 + D+P+ R + RPS+ A V+ + +VGGLHHRY WR+AA Sbjct: 143 IGDAPEGRRAEARPSANAAVVALPRVGGLHHRYAWRDAA 181
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A523KKE4_9DELT (DDE domain-containing protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A523KKE4_9DELT) HSP 1 Score: 54.3 bits (129), Expect = 2.050e-7 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 1 LRDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 + D+P R ++ RPS+ A V+ + +VGGLHHRY WREAA Sbjct: 309 IGDAPVGRPVESRPSADARVVSLPRVGGLHHRYVWREAA 347
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A1H2K9L2_9DELT (Integrase core domain-containing protein n=1 Tax=Desulfobacula phenolica TaxID=90732 RepID=A0A1H2K9L2_9DELT) HSP 1 Score: 53.1 bits (126), Expect = 2.430e-7 Identity = 22/38 (57.89%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 4 RDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 +DSP R +Q +P S+ +VIG+++VGGLHHRYEWR+ A Sbjct: 146 KDSPLGRPVQKKPESR-KVIGLNRVGGLHHRYEWRKTA 182
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A2V8DRS1_9BACT (Transposase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8DRS1_9BACT) HSP 1 Score: 53.1 bits (126), Expect = 3.210e-7 Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 4 RDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 +D P R++ RPS +++V+GI +VGGLHHRYEW +AA Sbjct: 171 KDPPLYRSVAERPSPQSKVVGIPRVGGLHHRYEWSQAA 208
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A6J4XDF0_9DELT (Integrase catalytic domain-containing protein n=1 Tax=Olavius sp. associated proteobacterium Delta 1 TaxID=698986 RepID=A0A6J4XDF0_9DELT) HSP 1 Score: 52.8 bits (125), Expect = 4.270e-7 Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 4 RDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 +D+P R Q RPS A+VI + VGGLHHRYEW+EAA Sbjct: 166 KDTPDERPAQPRPSMGAKVIELPLVGGLHHRYEWKEAA 203
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Match: A0A523EB66_9BACT (Integrase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A523EB66_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 6.310e-7 Identity = 20/38 (52.63%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 4 RDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA 117 +D+P R I R S +A+V+ + ++G LHHRYEWREAA Sbjct: 60 KDTPDERPITPRSSPRAKVVALPRMGSLHHRYEWREAA 97 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9747.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 22 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig9747.1.1 >prot_D-mesarthrocarpus_Contig9747.1.1 ID=prot_D-mesarthrocarpus_Contig9747.1.1|Name=mRNA_D-mesarthrocarpus_Contig9747.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=40bp LRDSPKSRAIQCRPSSKAEVIGISKVGGLHHRYEWREAA*back to top mRNA from alignment at D-mesarthrocarpus_Contig9747:3..122+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig9747.1.1 ID=mRNA_D-mesarthrocarpus_Contig9747.1.1|Name=mRNA_D-mesarthrocarpus_Contig9747.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=120bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9747:3..122+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig9747:3..122+ >mRNA_D-mesarthrocarpus_Contig9747.1.1 ID=mRNA_D-mesarthrocarpus_Contig9747.1.1|Name=mRNA_D-mesarthrocarpus_Contig9747.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=120bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9747:3..122+ (Discosporangium mesarthrocarpum MT17_79)back to top |